B3GNT5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: B3GNT5 Antibody [NBP1-88954] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli.
Immunohistochemistry-Paraffin: B3GNT5 Antibody [NBP1-88954] - Staining of human liver shows moderate granular positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B3GNT5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GAPPIRDKSSKYYVSYEMYQWPAYPDYTAGAAYVISGDVAAKVYEASQTLNSSLYIDDVFMGLCANKIGIVPQDHVFFSGEGKTPYHPCIYEKMMTSHGHLEDLQDLWKNATDPKV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B3GNT5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
B3GNT5 Protein (NBP1-88954PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B3GNT5 Antibody

  • B3GN-T5
  • beta 1,3 N-acetyglucosaminyltransferase Lc3 synthase
  • beta-1,3-Gn-T5
  • Beta-1,3-N-acetylglucosaminyltransferase 5
  • beta-1,3-N-acetylglucosaminyltransferase bGnT-5
  • beta3Gn-T5
  • BGnT-5
  • EC 2.4.1
  • EC 2.4.1.-
  • Lactotriaosylceramide synthase
  • Lc(3)Cer synthase
  • Lc3 synthase
  • UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-46562
Species: Hu
Applications: WB, IHC
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-92446
Species: Hu
Applications: WB, IHC, IHC-P
DDX0390P-100
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
AF4509
Species: Hu
Applications: WB, ICC
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88954
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for B3GNT5 Antibody (NBP1-88954) (0)

There are no publications for B3GNT5 Antibody (NBP1-88954).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GNT5 Antibody (NBP1-88954) (0)

There are no reviews for B3GNT5 Antibody (NBP1-88954). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for B3GNT5 Antibody (NBP1-88954) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B3GNT5 Products

Bioinformatics Tool for B3GNT5 Antibody (NBP1-88954)

Discover related pathways, diseases and genes to B3GNT5 Antibody (NBP1-88954). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B3GNT5 Antibody (NBP1-88954)

Discover more about diseases related to B3GNT5 Antibody (NBP1-88954).
 

Pathways for B3GNT5 Antibody (NBP1-88954)

View related products by pathway.

PTMs for B3GNT5 Antibody (NBP1-88954)

Learn more about PTMs related to B3GNT5 Antibody (NBP1-88954).

Blogs on B3GNT5

There are no specific blogs for B3GNT5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B3GNT5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GNT5