AZ1 Antibody

Images

 
Western Blot: AZ1 Antibody [NBP1-90053] - Western blot analysis in human cell line U-2 OS.
Immunocytochemistry/ Immunofluorescence: AZ1 Antibody [NBP1-90053] - Staining of human cell line A-431 shows positivity in centrosome. Antibody stainig is shown in green.
Immunohistochemistry-Paraffin: AZ1 Antibody [NBP1-90053] - Staining of human tonsil shows positivity in lymphoid cells.
Immunohistochemistry-Paraffin: AZ1 Antibody [NBP1-90053] - Staining of human fallopian tube shows positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: AZ1 Antibody [NBP1-90053] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AZ1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DFLMLFEGSPSGKKRPASLSTAPSEKGATWNVLDDQPRGFTLPSNARSSSALDSPAGPRRKECTVALAPNFTANNRSNKGAVGNCVTTM
Specificity
Specificity of human AZ1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AZI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publication using NBP1-90053.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24550735)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AZ1 Antibody

  • 5-azacytidine induced 1
  • 5-azacytidine-induced protein 1
  • AZ1
  • centrosomal protein 131 kDa
  • centrosomal protein of 131 kDa
  • CEP131
  • KIAA1118
  • pre-acrosome localization protein 1
  • ZA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88924
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56186
Species: Hu
Applications: ICC/IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
MAB7185
Species: Hu
Applications: WB, Simple Western
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IHC-Fr, IP
NBP1-87196
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-15447
Species: Hu
Applications: WB
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB100-240
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC

Publications for AZ1 Antibody (NBP1-90053)(1)

Reviews for AZ1 Antibody (NBP1-90053) (0)

There are no reviews for AZ1 Antibody (NBP1-90053). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AZ1 Antibody (NBP1-90053) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AZ1 Products

Array NBP1-90053

Bioinformatics Tool for AZ1 Antibody (NBP1-90053)

Discover related pathways, diseases and genes to AZ1 Antibody (NBP1-90053). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AZ1 Antibody (NBP1-90053)

Discover more about diseases related to AZ1 Antibody (NBP1-90053).
 

Pathways for AZ1 Antibody (NBP1-90053)

View related products by pathway.

PTMs for AZ1 Antibody (NBP1-90053)

Learn more about PTMs related to AZ1 Antibody (NBP1-90053).

Blogs on AZ1

There are no specific blogs for AZ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AZ1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AZI1