AZ1 Antibody - BSA Free

Western Blot: AZ1 Antibody [NBP1-90053] - Western blot analysis in human cell line U-2 OS.

Immunocytochemistry/Immunofluorescence: AZ1 Antibody [NBP1-90053] - Staining of human cell line A-431 shows positivity in centrosome. Antibody stainig is shown in green.

Immunohistochemistry-Paraffin: AZ1 Antibody [NBP1-90053] - Staining of human tonsil shows positivity in lymphoid cells.

Immunohistochemistry-Paraffin: AZ1 Antibody [NBP1-90053] - Staining of human fallopian tube shows positivity in cilia in glandular cells.

Immunohistochemistry-Paraffin: AZ1 Antibody [NBP1-90053] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AZ1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DFLMLFEGSPSGKKRPASLSTAPSEKGATWNVLDDQPRGFTLPSNARSSSALDSPAGPRRKECTVALAPNFTANNRSNKGAVGNCVTTM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CEP131
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  AZ1 Protein (NBP1-90053PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AZ1 Antibody - BSA Free

• 5-azacytidine induced 1
• 5-azacytidine-induced protein 1
• AZ1
• centrosomal protein 131 kDa
• centrosomal protein of 131 kDa
• CEP131
• KIAA1118
• pre-acrosome localization protein 1
• ZA1

Background

CEP131/AZ1 was originally identified as a transcript that was increased in cells exposed to the demethylating agent, azacytidine. It was found to localize to the pre-acrosome region of spermatids and therefore thought to play a role in spermatogenesis. CEP131/AZ1 has also been identified as a component of the centrosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AZ1 Antibody (NBP1-90053)(1)

Publication using NBP1-90053

• Chamling X, Seo S, Searby CC et al. The Centriolar Satellite Protein AZI1 Interacts with BBS4 and Regulates Ciliary Trafficking of the BBSome. PLoS Genet 2014-02-01 [PMID: 24550735]

Bioinformatics

• Gene Symbol: CEP131