Axotrophin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Axotrophin Antibody [NBP1-90057] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.

Immunohistochemistry-Paraffin: Axotrophin Antibody [NBP1-90057] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: Axotrophin Antibody [NBP1-90057] - Staining of human cerebral cortex, colon, liver and lymph node using Anti-MARCH7 antibody NBP1-90057 (A) shows similar protein distribution across tissues to independent antibody NBP1-90056 (B).

Immunohistochemistry-Paraffin: Axotrophin Antibody [NBP1-90057] - Staining of human liver.

Immunohistochemistry-Paraffin: Axotrophin Antibody [NBP1-90057] - Staining of human colon.

Immunohistochemistry-Paraffin: Axotrophin Antibody [NBP1-90057] - Staining of human lymph node.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Axotrophin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILPGSLFRFAVPPALGSNLTDNVMITVDIIPSGWNSADGKSDKTKSAPSRDPERLQKIK
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MARCH7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICCIF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Axotrophin Protein (NBP1-90057PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Axotrophin Antibody - BSA Free

• AXO
• AXOT
• Axotrophin
• E3 ubiquitin-protein ligase MARCH7
• EC 6.3.2
• EC 6.3.2.-
• MARCH-VIIDKFZp586F1122
• membrane-associated ring finger (C3HC4) 7
• Membrane-associated RING finger protein 7
• Membrane-associated RING-CH protein VII
• RING finger protein 177
• RNF177axotrophin

Background

E3 ubiquitin-protein ligase which may specifically enhance the E2 activity of HIP2. E3 ubiquitin ligasesaccept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer theubiquitin to targeted substrates

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Axotrophin Antibody (NBP1-90057)(1)

Publication using NBP1-90057

• Szigyarto CA, Sibbons P, Williams G et al. The E3 Ligase Axotrophin/MARCH-7: Protein Expression Profiling of Human Tissues Reveals Links to Adult Stem Cells. J Histochem Cytochem 2010-04-01 [PMID: 19901269]

Bioinformatics

• Gene Symbol: MARCH7