Axotrophin Antibody


Immunocytochemistry/ Immunofluorescence: Axotrophin Antibody [NBP1-90057] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Axotrophin Antibody [NBP1-90057] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Axotrophin Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:ILPGSLFRFAVPPALGSNLTDNVMITVDIIPSGWNSADGKSDKTKSAPSRDPERLQKIK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Axotrophin Protein (NBP1-90057PEP)
Read Publication using NBP1-90057.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19901269)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Axotrophin Antibody

  • AXO
  • AXOT
  • Axotrophin
  • E3 ubiquitin-protein ligase MARCH7
  • EC 6.3.2
  • EC 6.3.2.-
  • MARCH-VIIDKFZp586F1122
  • membrane-associated ring finger (C3HC4) 7
  • Membrane-associated RING finger protein 7
  • Membrane-associated RING-CH protein VII
  • RING finger protein 177
  • RNF177axotrophin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Fe, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Neut
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P

Publications for Axotrophin Antibody (NBP1-90057)(1)

Reviews for Axotrophin Antibody (NBP1-90057) (0)

There are no reviews for Axotrophin Antibody (NBP1-90057). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Axotrophin Antibody (NBP1-90057) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Axotrophin Products

Bioinformatics Tool for Axotrophin Antibody (NBP1-90057)

Discover related pathways, diseases and genes to Axotrophin Antibody (NBP1-90057). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Axotrophin Antibody (NBP1-90057)

Discover more about diseases related to Axotrophin Antibody (NBP1-90057).

Pathways for Axotrophin Antibody (NBP1-90057)

View related products by pathway.

Research Areas for Axotrophin Antibody (NBP1-90057)

Find related products by research area.

Blogs on Axotrophin

There are no specific blogs for Axotrophin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Axotrophin Antibody and receive a gift card or discount.


Gene Symbol MARCH7