Recombinant Human Aurora C Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Aurora C Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-309 of Human AURKC full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS

Protein/Peptide Type
Recombinant Protein
Gene
AURKC

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Aurora C Protein

  • AIE2AIK3
  • ARK3Serine/threonine-protein kinase aurora-C
  • AurC
  • aurora kinase CAurora/IPL1/Eg2 protein 2
  • Aurora/IPL1-related kinase 3
  • aurora-C
  • Aurora-related kinase 3
  • EC 2.7.11
  • EC 2.7.11.1
  • serine/threonine kinase 13 (aurora/IPL1-like)
  • serine/threonine-protein kinase 13
  • STK13ARK-3

Background

This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00027033-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB110-85519
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
H00009266-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP1-97587
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
H00006795-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Aurora C Recombinant Protein (H00006795-P01) (0)

There are no publications for Aurora C Recombinant Protein (H00006795-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aurora C Recombinant Protein (H00006795-P01) (0)

There are no reviews for Aurora C Recombinant Protein (H00006795-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aurora C Recombinant Protein (H00006795-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aurora C Products

Bioinformatics Tool for Aurora C Recombinant Protein (H00006795-P01)

Discover related pathways, diseases and genes to Aurora C Recombinant Protein (H00006795-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aurora C Recombinant Protein (H00006795-P01)

Discover more about diseases related to Aurora C Recombinant Protein (H00006795-P01).
 

Pathways for Aurora C Recombinant Protein (H00006795-P01)

View related products by pathway.

PTMs for Aurora C Recombinant Protein (H00006795-P01)

Learn more about PTMs related to Aurora C Recombinant Protein (H00006795-P01).
 

Research Areas for Aurora C Recombinant Protein (H00006795-P01)

Find related products by research area.

Blogs on Aurora C

There are no specific blogs for Aurora C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Aurora C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AURKC