Atrial Natriuretic Peptide/ANP Antibody [Alexa Fluor® 532]

• Reactivity: Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Alexa Fluor 532

Atrial Natriuretic Peptide/ANP Antibody [Alexa Fluor® 532] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 26-151 of human Atrial Natriuretic Peptide/ANP (NP_006154.1).
  
  Sequence:
  LTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPESDSGLSLN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPPA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Atrial Natriuretic Peptide/ANP Antibody [Alexa Fluor® 532]

• ANF
• ANP
• ANPatriopeptin
• ATFB6
• atrial natriuretic factor
• Atrial Natriuretic Peptide
• Cardionatrin
• CDD-ANF
• natriuretic peptide A
• natriuretic peptide precursor A
• NPPA
• PND
• PNDcardionatrin
• prepronatriodilatin

Background

Atrial natriuretic factor (ANP) is a potent vasoactive substance which is thought to play a key role in cardiovascular homeostasis and has a cGMP stimulating activity. There are two different prepronatriodilatin alleles. One codes for 2 Arginine residues at the C terminus that are cleaved to form the mature peptide, while the other ends in a termination codon immediately after the last codon of the mature peptide. ANP belongs to the natriuretic peptide family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPPA