Atrial Natriuretic Peptide/ANP Antibody (2C5S5)

Western Blot: Atrial Natriuretic Peptide/ANP Antibody (2C5S5) [NBP3-33325] - Western blot analysis of lysates from wild type (WT) and 293T cells transfected with Atrial Natriuretic Peptide/ANP using Atrial Natriuretic Peptide/ANP Rabbit mAb at 1:5000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.

Immunocytochemistry/ Immunofluorescence: Atrial Natriuretic Peptide/ANP Antibody (2C5S5) [NBP3-33325] - Confocal imaging of paraffin-embedded mouse heart using Atrial Natriuretic Peptide/ANP Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clone: 2C5S5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Atrial Natriuretic Peptide/ANP Antibody (2C5S5) Summary

• Description: Novus Biologicals Rabbit Atrial Natriuretic Peptide/ANP Antibody (2C5S5) (NBP3-33325) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atrial Natriuretic Peptide/ANP (NP_006163.1).
  
  Sequence:
  MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRG
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: NPPA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:2000 - 1:6000
• Theoretical MW: 16 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Atrial Natriuretic Peptide/ANP Antibody (2C5S5)

• ANF
• ANP
• ANPatriopeptin
• ATFB6
• atrial natriuretic factor
• Atrial Natriuretic Peptide
• Cardionatrin
• CDD-ANF
• natriuretic peptide A
• natriuretic peptide precursor A
• NPPA
• PND
• PNDcardionatrin
• prepronatriodilatin

Background

Atrial natriuretic factor (ANP) is a potent vasoactive substance which is thought to play a key role in cardiovascular homeostasis and has a cGMP stimulating activity. There are two different prepronatriodilatin alleles. One codes for 2 Arginine residues at the C terminus that are cleaved to form the mature peptide, while the other ends in a termination codon immediately after the last codon of the mature peptide. ANP belongs to the natriuretic peptide family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPPA