ATR Recombinant Protein Antigen

Images

 
There are currently no images for ATR Recombinant Protein Antigen (NBP2-76547PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ATR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATR

Source: E.coli

Amino Acid Sequence: FAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-76547. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ATR Recombinant Protein Antigen

  • ataxia telangiectasia and Rad3 related
  • Ataxia telangiectasia and Rad3-related protein
  • ATR
  • EC 2.7.11.1
  • FRAP-related protein 1
  • FRP1
  • FRP1FRAP-related protein-1
  • MEC1
  • protein kinase ATR
  • Rad3 related protein
  • SCKL1
  • SCKLMEC1, mitosis entry checkpoint 1, homolog
  • serine/threonine-protein kinase ATR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-309
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
NB100-464
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF2288
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, PAGE, KO
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NB100-404
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-247
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-02004
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-304
Species: Hu, Mu, Rt, Bt, Bv, Ca, Fi, Gt, Pm
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, Flow-IC, KD, KO
NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATR Recombinant Protein Antigen (NBP2-76547PEP) (0)

There are no publications for ATR Recombinant Protein Antigen (NBP2-76547PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATR Recombinant Protein Antigen (NBP2-76547PEP) (0)

There are no reviews for ATR Recombinant Protein Antigen (NBP2-76547PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATR Recombinant Protein Antigen (NBP2-76547PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional ATR Products

Array NBP2-76547PEP

Bioinformatics Tool for ATR Recombinant Protein Antigen (NBP2-76547PEP)

Discover related pathways, diseases and genes to ATR Recombinant Protein Antigen (NBP2-76547PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATR Recombinant Protein Antigen (NBP2-76547PEP)

Discover more about diseases related to ATR Recombinant Protein Antigen (NBP2-76547PEP).
 

Pathways for ATR Recombinant Protein Antigen (NBP2-76547PEP)

View related products by pathway.

PTMs for ATR Recombinant Protein Antigen (NBP2-76547PEP)

Learn more about PTMs related to ATR Recombinant Protein Antigen (NBP2-76547PEP).
 

Research Areas for ATR Recombinant Protein Antigen (NBP2-76547PEP)

Find related products by research area.

Blogs on ATR.

Further unraveling the role of gamma H2AX in DNA damage response
Our genome experiences a moderate amount of DNA damage in our cells on a daily basis.  This DNA damage can be in response to external environmental factors, or be a result of our internal metabolic processes going awry.  While normal rates of DNA ...  Read full blog post.

The recent relationship of BRCA1 and 53BP1
The p53-binding protein 1 (53BP1) is a DNA damage response factor, which is recruited to nuclear structures at the site of DNA damage.  DNA double-strand breaks (DSBs) are mutations that are detrimental to cell viability and genome stability, and m...  Read full blog post.

Customers Who Bought This Also Bought

53BP1 Antibody
NB100-304
Nbs1 Antibody
NB100-143

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATR Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATR