ATR Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ATR Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATR.
  
  

  Source: E. coli

  Amino Acid Sequence: FAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ATR
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76547.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATR Recombinant Protein Antigen

• ataxia telangiectasia and Rad3 related
• Ataxia telangiectasia and Rad3-related protein
• ATR
• EC 2.7.11.1
• FRAP-related protein 1
• FRP1
• FRP1FRAP-related protein-1
• MEC1
• protein kinase ATR
• Rad3 related protein
• SCKL1
• SCKLMEC1, mitosis entry checkpoint 1, homolog
• serine/threonine-protein kinase ATR

Background

Ataxia Telangiectasia Mutated (ATM) and Rad3- related (ATR) protein is a member of the phosphatidyl-inositol 3-kinase (PI 3-kinase) like family of protein kinases. ATR has a predicted molecular mass of approximately 301 kDa, and it has been shown to be involved in cellular responses to DNA damage. Specifically, it plays a role in checkpoint activation in response to either the presence of stalled replication forks, or by the presence of lesions caused by UV light. Inactivation of ATR is an embryonic lethal event in mice.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ATR