ATPase Na+/K+ beta 3 Antibody (2F4)

Images

 
ELISA: ATPase Na+/K+ beta 3 Antibody (2F4) [H00000483-M05] - Detection limit for recombinant GST tagged ATP1B3 is approximately 3ng/ml as a capture antibody.
ELISA: ATPase Na+/K+ beta 3 Antibody (2F4) [H00000483-M05] - Detection limit for recombinant GST tagged ATP1B3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, BvSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
2F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATPase Na+/K+ beta 3 Antibody (2F4) Summary

Immunogen
ATP1B3 (AAH11835, 1 a.a. ~ 279 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Specificity
ATP1B3 - ATPase, Na+/K+ transporting, beta 3 polypeptide
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATP1B3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. Use in Western blot reported in scientific literature (PMID 28134274).
Publications
Read Publications using H00000483-M05.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATPase Na+/K+ beta 3 Antibody (2F4)

  • ATPase, Na+/K+ transporting, beta 3 polypeptide
  • ATPB-3
  • CD298 antigen
  • CD298
  • FLJ29027
  • Na, K-ATPase beta-3 polypeptide
  • sodium/potassium-dependent ATPase beta-3 subunit
  • Sodium/potassium-dependent ATPase subunit beta-3
  • sodium/potassium-transporting ATPase beta-3 chain
  • sodium/potassium-transporting ATPase subunit beta-3

Background

The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-146
Species: Hu, Mu, Rt, Po, Bv, Ca, Dr, Gp, Pm, Rb, Sh, Xp, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-76538
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NB300-540
Species: Hu, Mu, Rt, Bv, Ca, Gp, Pm, Rb, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, B/N
NB300-147
Species: Hu, Rt, Po, Bv, Ca, Ch, Ha, Rb, Xp, Mu(-)
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75478
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB600-1318
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP1-85666
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54376
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-13431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ATPase Na+/K+ beta 3 Antibody (H00000483-M05)(2)

Reviews for ATPase Na+/K+ beta 3 Antibody (H00000483-M05) (0)

There are no reviews for ATPase Na+/K+ beta 3 Antibody (H00000483-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATPase Na+/K+ beta 3 Antibody (H00000483-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ATPase Na+/K+ beta 3 Products

Bioinformatics Tool for ATPase Na+/K+ beta 3 Antibody (H00000483-M05)

Discover related pathways, diseases and genes to ATPase Na+/K+ beta 3 Antibody (H00000483-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATPase Na+/K+ beta 3 Antibody (H00000483-M05)

Discover more about diseases related to ATPase Na+/K+ beta 3 Antibody (H00000483-M05).
 

Pathways for ATPase Na+/K+ beta 3 Antibody (H00000483-M05)

View related products by pathway.

PTMs for ATPase Na+/K+ beta 3 Antibody (H00000483-M05)

Learn more about PTMs related to ATPase Na+/K+ beta 3 Antibody (H00000483-M05).

Blogs on ATPase Na+/K+ beta 3

There are no specific blogs for ATPase Na+/K+ beta 3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATPase Na+/K+ beta 3 Antibody (2F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP1B3
Entrez
OMIM
Uniprot