ATP6V1D Antibody

Images

 
Western Blot: ATP6V1D Antibody [NBP1-88895] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: ATP6V1D Antibody [NBP1-88895] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP1-88895] - Staining of human kidney shows strong membranous positivity in cells in tubules.
Western Blot: ATP6V1D Antibody [NBP1-88895] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: ATP6V1D Antibody [NBP1-88895] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP6V1D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V1D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATP6V1D Protein (NBP1-88895PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP6V1D Antibody

  • ATP6M
  • ATPase, H+ transporting lysosomal, member M
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump)
  • ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D
  • H(+)-transporting two-sector ATPase, subunit M
  • vacuolar ATP synthase subunit D
  • vacuolar H-ATPase subunit D
  • vacuolar proton pump D subunit
  • vacuolar proton pump delta polypeptide
  • Vacuolar proton pump subunit D
  • vacuolar proton-ATPase subunit D
  • VATDV-ATPase D subunit
  • V-ATPase 28 kDa accessory protein
  • V-ATPase subunit D
  • VMA8
  • V-type proton ATPase subunit D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-00892
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00009114-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31600
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-83954
Species: Hu
Applications: IHC, IHC-P
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
AF3296
Species: Hu, Mu, Rt
Applications: WB
H00008940-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-59168
Species: Hu
Applications: WB
7570-GH
Species: Hu
NBP2-48748
Species: Hu
Applications: WB, IHC
NB100-1888
Species: Hu, Mu, Rt
Applications: WB, IHC, PEP-ELISA
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP2-38122
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-266
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38644
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATP6V1D Antibody (NBP1-88895) (0)

There are no publications for ATP6V1D Antibody (NBP1-88895).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1D Antibody (NBP1-88895) (0)

There are no reviews for ATP6V1D Antibody (NBP1-88895). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATP6V1D Antibody (NBP1-88895) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP6V1D Products

Bioinformatics Tool for ATP6V1D Antibody (NBP1-88895)

Discover related pathways, diseases and genes to ATP6V1D Antibody (NBP1-88895). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1D Antibody (NBP1-88895)

Discover more about diseases related to ATP6V1D Antibody (NBP1-88895).
 

Pathways for ATP6V1D Antibody (NBP1-88895)

View related products by pathway.

Blogs on ATP6V1D

There are no specific blogs for ATP6V1D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V1D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1D