ATP6V1C2 Antibody (3D5) - Azide and BSA Free

Western Blot: ATP6V1C2 Antibody (3D5) [H00245973-M01] - ATP6V1C2 monoclonal antibody (M01), clone 3D5 Analysis of ATP6V1C2 expression in HeLa.

Sandwich ELISA: ATP6V1C2 Antibody (3D5) [H00245973-M01] - Detection limit for recombinant GST tagged ATP6V1C2 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3D5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATP6V1C2 Antibody (3D5) - Azide and BSA Free Summary

• Immunogen: ATP6V1C2 (NP_653184, 188 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYD
• Specificity: ATP6V1C2 - ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C isoform 2
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATP6V1C2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP6V1C2 Antibody (3D5) - Azide and BSA Free

• ATP6C2
• ATPase, H+ transporting, lysosomal 42kD, V1 subunit C isoform 2
• ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C isoform 2
• ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2
• Vacuolar proton pump subunit C 2
• V-ATPase C2 subunit
• V-ATPase subunit C 2
• VMA5
• V-type proton ATPase subunit C 2

Background

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A,three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain C subunit isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP6V1C2
• Entrez:
  • 245973(Human)
• Uniprot:
  • NP_653184(Human)