ATP6V0D2 Antibody

Images

 
Western Blot: ATP6V0D2 Antibody [NBP3-10978] - Western blot analysis of ATP6V0D2 in Mouse Lung lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

ATP6V0D2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse ATP6V0D2 (NP_780615.2). Peptide sequence IITLNSFGTELSKEDRETLFPTCGRLYPEGLRLLAQAEDFEQMKRVADNY
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V0D2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for ATP6V0D2 Antibody

  • ATP6D2
  • ATP6V0
  • ATPase, H+ transporting, lysosomal 38kD, V0 subunit d isoform 2
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
  • FLJ38708
  • Vacuolar proton pump subunit d 2
  • V-ATPase subunit d 2
  • VMA6
  • V-type proton ATPase subunit d 2

Background

ATP6V0D2 - ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP6V0D2 Antibody (NBP3-10978) (0)

There are no publications for ATP6V0D2 Antibody (NBP3-10978).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V0D2 Antibody (NBP3-10978) (0)

There are no reviews for ATP6V0D2 Antibody (NBP3-10978). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V0D2 Antibody (NBP3-10978) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V0D2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V0D2