ATP6V0A1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ATP6V0A1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP6V0A1.
  
  

  Source: E. coli

  Amino Acid Sequence: VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ATP6V0A1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89342.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATP6V0A1 Recombinant Protein Antigen

• a1
• ATP6N1
• ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD)
• ATP6V0
• ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD)
• ATPase, H+ transporting, lysosomal V0 subunit a isoform 1
• ATPase, H+ transporting, lysosomal V0 subunit a1
• Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit
• DKFZp781J1951
• Stv1
• Vacuolar adenosine triphosphatase subunit Ac116
• Vacuolar proton pump subunit 1
• vacuolar proton pump, subunit 1
• Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1
• vacuolar proton translocating ATPase 116 kDa subunit A
• vacuolar-type H(+)-ATPase 115 kDa subunit
• V-ATPase 116 kDa isoform a1
• V-ATPase 116 kDa
• Vph1
• VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1
• V-type proton ATPase 116 kDa subunit a isoform 1
• V-type proton ATPase 116 kDa subunit a

Background

ATP6V0A1 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three A subunit proteins and the encoded protein is associated with clathrin-coated vesicles. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ATP6V0A1