We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human ATP5J GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human ATP5J Protein [H00000522-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human ATP5J GST (N-Term) Protein Summary

Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-108 of Human ATP5J

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ATP5PF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATP5J GST (N-Term) Protein

  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6
  • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F6
  • ATP5
  • ATP5A
  • ATPase subunit F6
  • ATPM
  • coupling factor 6
  • F6
  • mitochondrial ATP synthase, coupling factor 6
  • mitochondrial ATP synthase, subunit F6
  • mitochondrial ATPase coupling factor 6
  • mitochondrial
  • proliferation-inducing protein 36

Background

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the F6 subunit of the F0 complex, required for F1 and F0 interactions. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-25459
Species: Hu, Rt
Applications: WB
AF904
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-92921
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2338
Species: Hu
Applications: ICC, IP, WB
NBP1-82473
Species: Hu
Applications: IHC,  IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-12581
Species: Hu
Applications: IHC,  IHC-P, WB
211-TBB/CF
Species: Hu
Applications: BA
NBP1-33581
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00000522-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for ATP5J Recombinant Protein (H00000522-P01) (0)

There are no publications for ATP5J Recombinant Protein (H00000522-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5J Recombinant Protein (H00000522-P01) (0)

There are no reviews for ATP5J Recombinant Protein (H00000522-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP5J Recombinant Protein (H00000522-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP5J Products

Research Areas for ATP5J Recombinant Protein (H00000522-P01)

Find related products by research area.

Blogs on ATP5J

There are no specific blogs for ATP5J, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATP5J GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP5PF