COX6B1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: COX6B1 Antibody [NBP1-85497] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: COX6B1 Antibody [NBP1-85497] - Staining in human heart muscle and pancreas tissues using anti-COX6B1 antibody. Corresponding COX6B1 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: COX6B1 Antibody [NBP1-85497] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: COX6B1 Antibody [NBP1-85497] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

COX6B1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFP
Specificity
Specificity of human, mouse, rat COX6B1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COX6B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse (84%), Rat (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COX6B1 Antibody

  • COX VIb-1
  • COX6B
  • COXG
  • COXVIb1
  • cytochrome c oxidase subunit 6B1
  • Cytochrome c oxidase subunit VIb isoform 1
  • cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous)
  • cytochrome c oxidase subunit Vib

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001351-P01
Species: Hu
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45645
Species: Hu
Applications: WB, IHC, IF
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NB110-39115
Species: Hu, Mu, Rt, Po, Bv, Dr, I, Op, Pm
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, KD
NBP1-98535
Species: Hu
Applications: WB
NBP2-46865
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001350-P01
Species: Hu
NBP1-85500
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-31112
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89499
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001349-P01
Species: Hu
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14694
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
NBP2-22217
Species: Hu, Mu, Ch, Rt(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP2-14694
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
NBP1-82486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85497
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for COX6B1 Antibody (NBP1-85497) (0)

There are no publications for COX6B1 Antibody (NBP1-85497).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX6B1 Antibody (NBP1-85497) (0)

There are no reviews for COX6B1 Antibody (NBP1-85497). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COX6B1 Antibody (NBP1-85497) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional COX6B1 Products

Bioinformatics Tool for COX6B1 Antibody (NBP1-85497)

Discover related pathways, diseases and genes to COX6B1 Antibody (NBP1-85497). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX6B1 Antibody (NBP1-85497)

Discover more about diseases related to COX6B1 Antibody (NBP1-85497).
 

Pathways for COX6B1 Antibody (NBP1-85497)

View related products by pathway.

PTMs for COX6B1 Antibody (NBP1-85497)

Learn more about PTMs related to COX6B1 Antibody (NBP1-85497).

Blogs on COX6B1

There are no specific blogs for COX6B1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX6B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COX6B1
Novus 100% Guarantee