ATP2C1 Antibody

Images

 
Immunohistochemistry-Paraffin: ATP2C1 Antibody [NBP1-88887] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP2C1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP2C1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP2C1 Protein (NBP1-88887PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP2C1 Antibody

  • ATPase, Ca++ transporting, type 2C, member 1
  • BCPM
  • benign chronic pemphigus (Hailey-Hailey disease)
  • Ca(2+)-sequestering
  • calcium-transporting ATPase type 2C member 1
  • EC 3.6.3
  • HHD
  • hSPCA1
  • HUSSY-28
  • PMR1L
  • secretory pathway Ca2+/Mn2+ ATPase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
AF2338
Species: Hu
Applications: WB, IP, ICC
NBP1-76567
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB120-3529
Species: Hu, Rt, Po
Applications: WB, ELISA, IHC-Fr, IHC-P
NBP1-30865
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37956
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92177
Species: Hu
Applications: IHC, IHC-P
NB300-569
Species: Hu, Mu, Rt, Po, Am, Bv, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-88887
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for ATP2C1 Antibody (NBP1-88887) (0)

There are no publications for ATP2C1 Antibody (NBP1-88887).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP2C1 Antibody (NBP1-88887) (0)

There are no reviews for ATP2C1 Antibody (NBP1-88887). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP2C1 Antibody (NBP1-88887) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP2C1 Products

Bioinformatics Tool for ATP2C1 Antibody (NBP1-88887)

Discover related pathways, diseases and genes to ATP2C1 Antibody (NBP1-88887). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP2C1 Antibody (NBP1-88887)

Discover more about diseases related to ATP2C1 Antibody (NBP1-88887).
 

Pathways for ATP2C1 Antibody (NBP1-88887)

View related products by pathway.

PTMs for ATP2C1 Antibody (NBP1-88887)

Learn more about PTMs related to ATP2C1 Antibody (NBP1-88887).

Blogs on ATP2C1

There are no specific blogs for ATP2C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP2C1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP2C1