ATP2C1 Antibody - BSA Free

Immunohistochemistry-Paraffin: ATP2C1 Antibody [NBP1-88887] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATP2C1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ATP2C1 Antibody - BSA Free (NBP1-88887) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGD
• Predicted Species: Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP2C1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ATP2C1 Protein (NBP1-88887PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ATP2C1 Antibody - BSA Free

• ATPase, Ca++ transporting, type 2C, member 1
• BCPM
• benign chronic pemphigus (Hailey-Hailey disease)
• Ca(2+)-sequestering
• calcium-transporting ATPase type 2C member 1
• EC 3.6.3
• HHD
• hSPCA1
• HUSSY-28
• PMR1L
• secretory pathway Ca2+/Mn2+ ATPase 1

Background

ATP2C1 is encoded by this gene belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP2C1