ATP12A Antibody - Azide and BSA Free

Western Blot: ATP12A Antibody [NBP2-92160] - Analysis of extracts of various cell lines, using ATP12A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 5s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATP12A Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit ATP12A Antibody - Azide and BSA Free (NBP2-92160) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 890-980 of human ATP12A (NP_001172014.1). YFTVYAQEGFLPRTLINLRVEWEKDYVNDLKDSYGQEWTRYQREYLEWTGYTAFFVGILVQQIADLIIRKTRRNSIFQQGLFRNKVIWVGI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP12A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 116 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ATP12A Antibody - Azide and BSA Free

• ATP1AL1non-gastric H(+)/K(+) ATPase alpha subunit
• ATPase, H+/K+ transporting, nongastric, alpha polypeptide
• ATPase, Na+/K+ transporting, alpha polypeptide-like 1
• EC 3.6.3
• EC 3.6.3.10
• Non-gastric H(+)/K(+) ATPase subunit alpha
• potassium-transporting ATPase alpha chain 2
• Proton pump

Background

ATP12A is encoded by this gene belongs to the family of P-type cation transport ATPases. This gene encodes a catalytic subunit of the ouabain-sensitive H+/K+ -ATPase that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for potassium absorption in various tissues. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ATP12A