ATG2B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ATG2B Antibody [NBP1-90731] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ATG2B Antibody [NBP1-90731] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATG2B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SQIQEPCCSDLFLFPDESGNVSQESGPTYASFSHHFISDAMTGVPTENDDFCILFAPKAAMQEKEEEPVIKIMVDDAIVIRDNYFSLPVNKTDTSKAPLHFPIPVIRYVVKEVSLVWHLYGGKDFGTVPPTSPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATG2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATG2B Protein (NBP1-90731PEP)
Publications
Read Publication using
NBP1-90731 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (80%). Human reactivity reported in scientific literature (PMID: 25524633).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATG2B Antibody

  • ATG2 autophagy related 2 homolog B (S. cerevisiae)
  • C14orf103
  • FLJ10242

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-77169
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IF
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-88878
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP2-15501
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NBP1-83009
Species: Hu
Applications: IHC, IHC-P
NBP1-89043
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76377
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24594
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-14326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32470
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-90731
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ATG2B Antibody (NBP1-90731)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ATG2B Antibody (NBP1-90731) (0)

There are no reviews for ATG2B Antibody (NBP1-90731). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATG2B Antibody (NBP1-90731) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATG2B Products

ATG2B NBP1-90731

Bioinformatics Tool for ATG2B Antibody (NBP1-90731)

Discover related pathways, diseases and genes to ATG2B Antibody (NBP1-90731). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATG2B Antibody (NBP1-90731)

Discover more about diseases related to ATG2B Antibody (NBP1-90731).
 

Pathways for ATG2B Antibody (NBP1-90731)

View related products by pathway.

Blogs on ATG2B

There are no specific blogs for ATG2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATG2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG2B