Recombinant Human ATG12 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ATG12 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-140 of Human ATG12 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ATG12

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATG12 Protein

  • Apg12 (autophagy 12, S. cerevisiae)-like
  • APG12 autophagy 12-like (S. cerevisiae)
  • APG12
  • APG12HAPG12
  • APG12-like
  • ATG12 autophagy related 12 homolog (S. cerevisiae)
  • ATG12
  • Autophagy-related protein 12
  • FBR93
  • HAPG12
  • ubiquitin-like protein ATG12
  • yeast) homolog

Background

Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog of a yeast protein involved in autophagy (Mizushima et al., 1998 [PubMed 9852036]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-24594
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-01083
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
H00009140-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for ATG12 Recombinant Protein (H00009140-P02) (0)

There are no publications for ATG12 Recombinant Protein (H00009140-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG12 Recombinant Protein (H00009140-P02) (0)

There are no reviews for ATG12 Recombinant Protein (H00009140-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATG12 Recombinant Protein (H00009140-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATG12 Products

Bioinformatics Tool for ATG12 Recombinant Protein (H00009140-P02)

Discover related pathways, diseases and genes to ATG12 Recombinant Protein (H00009140-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATG12 Recombinant Protein (H00009140-P02)

Discover more about diseases related to ATG12 Recombinant Protein (H00009140-P02).
 

Pathways for ATG12 Recombinant Protein (H00009140-P02)

View related products by pathway.

PTMs for ATG12 Recombinant Protein (H00009140-P02)

Learn more about PTMs related to ATG12 Recombinant Protein (H00009140-P02).
 

Research Areas for ATG12 Recombinant Protein (H00009140-P02)

Find related products by research area.

Blogs on ATG12. Showing 1-10 of 11 blog posts - Show all blog posts.

WIPI1 - An essential regulator of early autophagosome assembly
WD repeat domain phosphoinositide-interacting protein 1 (WIPI) is involved in the lysosomal degradation of cytoplasmic components during starvation-induced autophagy. WIPI1 is a seven bladed beta-propeller protein that provides a scaffold for the ...  Read full blog post.

ATG4C - A regulator of the early steps of autophagosome assembly
Autophagy is an important cellular process that maintains homeostasis by degrading and recycling damaged proteins and organelles. Autophagy receptors, such as p62/SQSTM1, recognize these intracellular cargo and mediate their engulfment by the doubl...  Read full blog post.

ATG16L2 - An autophagy-related protein with unknown functions
Autophagy is a process by which cells degrade and recycle damaged organelles or misfolded proteins. These various cargo are engulfed in a double-membrane structure called the autophagosome. The autophagosome then fuses with the lysosome to facilit...  Read full blog post.

ATG4D - A regulator of autophagy and apoptosis
Autophagy is an essential cellular process whereby damaged proteins and organelles are degraded and recycled. Autophagy, while happening constantly at a basal level, is tightly regulated and can be further induced under cellular stress. One of the...  Read full blog post.

ATG4B - a cysteine protease involved in autophagosome elongation
Autophagy can be broken down into 4 main stages: phagophore nucleation, autophagosome elongation, autophagosome docking and fusion with a lysosome, and vesicle breakdown and degradation. ATG4B is one of four ATG4 homologs (ATG4A, ATG4B, ATG4C, and...  Read full blog post.

ATG16L1 - a key player in the development of the autophagosome
Untitled DocumentLike apoptosis, autophagy is a highly regulated physiologic process that involves cellular degradation and recycling of organelles and macromolecules. Autophagy is a survival mechanism induced by states of stress, s...  Read full blog post.

ATG5 - an essential regulator of autophagosome assembly
Autophagy is important for the removal of damaged organelles or proteins as well as for the regulation of cellular homeostasis in response to stress. Proteins or organelles that are targeted for degradation are engulfed in a double-membrane structu...  Read full blog post.

ATG7 - an E1 enzyme for the ubiquitin-like autophagy proteins
Autophagy is an essential cellular process that maintains homeostasis through the degradation and recycling of cytoplasmic organelles and macromolecules. Substrates targeted for autophagy are engulfed in a double-membrane structure called the auto...  Read full blog post.

ATG12 - a ubiquitin-like protein essential for autophagosome assembly
Atg12 is a ubiquitin-like protein that plays an essential role in cellular homeostasis by regulating the degradation and recycling of cytoplasmic organelles and macromolecules. Atg12 is one of two ubiquitin-like protein systems that is required du...  Read full blog post.

LC3/LC3B - measuring autophagosome formation and autophagic flux
Microtubule-associated protein-1 light chain 3 (LC3/LC3B) is a ubiquitin-like protein involved in the formation of the autophagosome. It is homologous to the yeast Atg8 protein. Autophagosomes are important for the degradation and recycling of intr...  Read full blog post.

Showing 1-10 of 11 blog posts - Show all blog posts.

Customers Who Bought This Also Bought

LC3A Antibody
NB100-2331
ATG12 Antibody
NBP2-15501
ATG5 Antibody
NB110-53818

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATG12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG12
Entrez