New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

ATG101 Antibody

Images

 
Western Blot: ATG101 Antibody [NBP2-82692] - Host: Rabbit. Target Name: ATG101. Sample Type: COLO205 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATG101 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ATG101. Peptide sequence: PWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
C12ORF44
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATG101 Antibody

  • ATG101
  • Atg13-interacting protein
  • autophagy-related protein 101
  • C12orf44
  • chromosome 12 open reading frame 44
  • FLJ11773

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24738
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-77279
Species: Hu, Mu
Applications: IP, WB
NBP2-19127
Species: Hu, Mu
Applications: ELISA, Flow, KD, WB
NBP1-33136
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-36445
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP1-89865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
H00005564-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-82090
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-71771
Species: Dr, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBP1-87232
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
NBP1-55202
Species: Hu
Applications: IHC, IHC-P, WB

Publications for ATG101 Antibody (NBP2-82692) (0)

There are no publications for ATG101 Antibody (NBP2-82692).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG101 Antibody (NBP2-82692) (0)

There are no reviews for ATG101 Antibody (NBP2-82692). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATG101 Antibody (NBP2-82692) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATG101 Products

Bioinformatics Tool for ATG101 Antibody (NBP2-82692)

Discover related pathways, diseases and genes to ATG101 Antibody (NBP2-82692). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ATG101 Antibody (NBP2-82692)

View related products by pathway.

PTMs for ATG101 Antibody (NBP2-82692)

Learn more about PTMs related to ATG101 Antibody (NBP2-82692).
 

Research Areas for ATG101 Antibody (NBP2-82692)

Find related products by research area.

Blogs on ATG101

There are no specific blogs for ATG101, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATG101 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C12ORF44