Home » ATG10 » ATG10 Peptides and Proteins » ATG10 Recombinant Protein Antigen

ATG10 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ATG10 Protein (NBP2-38524PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

ATG10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATG10.

Source: E.coli

Amino Acid Sequence: IGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKM
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATG10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38524.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ATG10 Recombinant Protein Antigen

  • APG10 autophagy 10-like (S. cerevisiae)
  • APG10
  • APG10L
  • APG10-like
  • ATG10 autophagy related 10 homolog (S. cerevisiae)
  • ATG10
  • Autophagy-related protein 10
  • DKFZp586I0418
  • EC 6.3.2.-
  • FLJ13954
  • PP12616
  • ubiquitin-like-conjugating enzyme ATG10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ATG12 Antibody
NBP2-15501
Western Blot: ATG12 Antibody [NBP2-15501] - Sample (50 ug of whole cell lysate) A: Rat brain 12% SDS PAGE diluted at 1:1000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: ATG12 Antibody [NBP2-15501] - Human lung cancer. ATG12 stained by ATG12 antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Western Blot: ATG12 Antibody [NBP2-15501] - Sample (30 ug of whole cell lysate) A: NIH-3T3 12% SDS PAGE gel, diluted at 1:1000.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
ATG5 Antibody
NB110-53818
Western Blot: ATG5 Antibody [NB110-53818] - Western blot analysis in mouse wildtype ES cell lysate (Lane 1) using NB110-53818. Lane 2 is a mouse ATG5 KO ES cell lysate (negative control). Atg5-/- ES cells from Dr. Noboru Mizushima [Mizushima, N. et al. J. Cell Biol. 152 (2001)] Photo courtesy of Dr. Beth Levine, UT Southwestern Medical Center.
Western Blot: ATG5 Antibody [NB110-53818] - ERK phosphorylation in Atg5-/-cells depends on nutrient availability. Serum-deprived Atg5-/- MEFs display decreased ERK and p90RSK phosphorylation. Immunoblots for the indicated proteins in total lysates from 2 h serum-deprived WT and Atg5-/- MEFs. The bars represent mean+/-s.e.m. *P<0.05, ***P<0.001 compared with Con; Student's t-test, n=3. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/ncomms3799), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: ATG5 Antibody [NB110-53818] - ICC/IF analysis of SY5Y cells at 1:250. Incubated overnight at 4 degrees. Photo courtesy of an anonymous collaborator.
(7 Reviews)
(210 Publications)
Species: Hu, Mu, Rt, Po, Bv, Fi, Gp, Pm, Xp, Ze
Applications: WB, Simple Western, EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, RIA, KD, KO
ATG7 Antibody
(683906) [Unconjugate
MAB6608
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human ATG7 Monoclonal Antibody (Catalog # MAB6608) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ATG7 at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ATG7 was detected in formalin fixed paraffin-embedded sections of human brain (cortex) using Mouse Anti-Human ATG7 Monoclonal Antibody (Catalog # MAB6608) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to neuronal cell bodies and processes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for ATG7 at approximately 72 kDa (as indicated) using 20 µg/mL of Mouse Anti-Human/Mouse ATG7 Monoclonal Antibody (Catalog # MAB6608). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
GATE-16/GABARAPL2
Antibody
NBP2-82090
Western Blot: GATE-16/GABARAPL2 Antibody [NBP2-82090] - Analysis of GATE-16/GABARAPL2 in human brain tissue lysate with GATE-16/GABARAPL2 antibody at (A) 1 and (B) 2 ug/ml.
Immunocytochemistry/Immunofluorescence: GATE-16/GABARAPL2 Antibody [NBP2-82090] - Immunofluorescence of GATE-16/GABARAPL2 in mouse brain tissue with GATE-16/GABARAPL2 Antibody at 20 ug/mL. Green: GATE-16/GABARAPL2 Antibody (NBP2-82090). Blue: DAPI staining
Immunohistochemistry-Paraffin: GATE-16/GABARAPL2 Antibody [NBP2-82090] - Mouse brain tissue with at 5 ug/mL.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
GABARAPL1 Antibody
NBP1-55202
Western Blot: GABARAPL1 Antibody [NBP1-55202] - Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human Brain lysate tissue at an Antibody concentration of 5.0 ug/ml using anti-GABARAPL1 Antibody (NBP1-55202).
Western Blot: GABARAPL1 Antibody [NBP1-55202] - Transfected 293T tissue lysate at a concentration of 1ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
Beclin 1 Antibody
NB500-249
Western Blot: Beclin 1 Antibody [NB500-249] - Expression of Beclin 1 mRNA and protein in cells and tissues. (A) Beclin 1 mRNA expression level up-regulated in gastric cancer cell lines compared with normal gastric epithelial cells by reverse transcription-PCR. (B) Beclin 1 protein expression level up-regulated in gastric cancer cell lines compared with normal gastric epithelial cells by western blotting. (C) Beclin 1 mRNA expression is elevated in primary gastric tumors compared with paired gastric adjacent noncancerous tissues by reverse transcription-PCR. (D) Beclin 1 protein expression is elevated in primary gastric tumors compared with paired gastric adjacent noncancerous tissues by western blotting. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0045968) licensed under a CC-BY licence.
Simple Western: Beclin 1 Antibody [NB500-249] - Image shows a specific band for Beclin1 in 1.0 mg/mL of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunohistochemistry-Frozen: Beclin 1 Antibody [NB500-249] - Merged immunostaining of frozen section of Rat brain tissue. Image from verified customer review.
(8 Reviews)
(116 Publications)
Species: Hu, Mu, Rt, V
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
ATG3/APG3 Antibody
(OTI3H2)
NBP2-01083
Western Blot: ATG3/APG3 Antibody (OTI3H2) [NBP2-01083] - Analysis of extracts (35ug) from 9 different cell lines by using anti-Apg3 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunocytochemistry/Immunofluorescence: ATG3/APG3 Antibody (OTI3H2) [NBP2-01083] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Apg3.
Immunohistochemistry-Paraffin: ATG3/APG3 Antibody (OTI3H2) [NBP2-01083] - Staining of paraffin-embedded Human tonsil using anti-Apg3 mouse monoclonal antibody.
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Butyrylcholinesterase/ ...
AF9024
Western blot shows lysates of mouse heart tissue and mouse liver tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Mouse/Rat Butyrylcholinesterase/BCHE Polyclonal Antibody (Catalog # AF9024) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Butyrylcholinesterase/BCHE at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Butyrylcholinesterase/BCHE was detected in perfusion fixed frozen sections of mouse brain using Goat Anti-Mouse/Rat Butyrylcholinesterase/BCHE Antigen Affinity-purified Polyclonal Antibody (Catalog # AF9024) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit  (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to glial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Mu, Rt
Applications: WB, IHC
Elastase Antibody
(CELA3B/1257)
NBP2-53246
Immunohistochemistry-Paraffin: Elastase Antibody (CELA3B/1257) [NBP2-53246] - Formalin-fixed, paraffin-embedded Rat Pancreas stained with CELA3B Monoclonal Antibody (CELA3B/1257).
Immunohistochemistry-Paraffin: Elastase Antibody (CELA3B/1257) [NBP2-53246] - Formalin-fixed, paraffin-embedded Human Pancreas stained with CELA3B Monoclonal Antibody (CELA3B/1257)
Immunohistochemistry-Paraffin: Elastase Antibody (CELA3B/1257) [NBP2-53246] - Formalin-fixed, paraffin-embedded Mouse Pancreas stained with CELA3B Monoclonal Antibody (CELA3B/1257).
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
MASA Antibody
NBP2-13961
Western Blot: MASA Antibody [NBP2-13961] - Analysis in control (vector only transfected HEK293T lysate) and ENOPH1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: MASA Antibody [NBP2-13961] - Staining of human cell line MCF7 shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry-Paraffin: MASA Antibody [NBP2-13961] - Staining in human cerebral cortex and pancreas tissues using anti-ENOPH1 antibody. Corresponding ENOPH1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DBT Antibody
NBP1-89522
Western Blot: DBT Antibody [NBP1-89522] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human colon.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
WIPI1 Antibody
NBP1-88878
Western Blot: WIPI1 Antibody [NBP1-88878] - Analysis in human cell lines SK-MEL-30 and HeLa using anti-WIPI1 antibody. Corresponding WIPI1 RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.
Immunohistochemistry-Paraffin: WIPI1 Antibody [NBP1-88878] - Staining in human placenta and fallopian tube tissues using anti-WIPI1 antibody. Corresponding WIPI1 RNA-seq data are presented for the same tissues.
Western Blot: WIPI1 Antibody [NBP1-88878] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
LC3A Antibody
NB100-2331
Western Blot: LC3A Antibody [NB100-2331] - High autophagosome concentration is consumed during early immortalized human mesenchymal stem cell differentiation. Immortalized human mesenchymal stem cells were differentiated under osteogenic conditions (see Materials and methods) and assayed for changes in LC3I and LC3II during a 72-hour window. Cells were differentiated under standard conditions (top) or with addition of 5 uM rapamycin (middle) or 5 nM bafilomycin (bottom) for the first 3 hours of differentiation to modulate autophagy. Immunoblots were performed for LC3 at the indicated time points to assess autophagosome degradation via relative changes in LC3II (lower band; 17 kDa). Studies were repeated three times with similar trends seen consistently. Image collected and cropped by CiteAb from the following publication (http://stemcellres.com/content/5/6/140), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: LC3A Antibody [NB100-2331] - Analysis in PFA fixed NIH/3T3 cells using anti-LC3A antibody. Image from verified customer review.
Immunohistochemistry: LC3A Antibody [NB100-2331] - Staining in mouse meniscus and cartilage. Image from verified customer review.
(20 Reviews)
(255 Publications)
Species: Hu, Mu, Rt, Ca, Fi, Pl, V, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB, IHC-WhMt
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of whole cell lysate (WCL) of Jurkat cells using anti-Bcl-2 antibody (NB100-56098) at 1:1000 dilution. HRP conjugated goat anti-rabbit IgG (H+L) cross adsorbed secondary antibody was used with ECL substrate for the detection of Bcl2 antibody bound to the blotted protein. This Bcl2 antibody detected a specific band at expected molecular weight marker position of Bcl2 protein (26kDa).
Immunohistochemistry-Paraffin: Bcl-2 Antibody [NB100-56098] - Analysis of a FFPE human breast carcinoma tissue section using 1:1000 dilution of Bcl-2 antibody (NB100-56098) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of BCL2 in the cancer cells with relatively intense signal in their nuclear membranes. Staining was performed by Histowiz.
(2 Reviews)
(10 Publications)
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
p63/TP73L Antibody
[Unconjugated]
AF1916
p63/TP73L was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
p63/TP73L was detected in immersion fixed SCC-25 human tongue carcinoma cell line using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(4 Reviews)
(3 Publications)
Species: Hu
Applications: WB, IHC, ICC
SPANXB1 Antibody
H00728695-B01P
Western Blot: SPANXB1 Antibody [H00728695-B01P] - Analysis of SPANXB1 expression in transfected 293T cell line by SPANXB1 polyclonal antibody. Lane 1: SPANXB1 transfected lysate(11.33 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: SPANXB1 Antibody [H00728695-B01P] - Analysis of purified antibody to SPANXB1 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: WB, ICC/IF, IP
UVRAG Antibody
NBP1-18885
Western Blot: UVRAG Antibody [NBP1-18885] - Beclin 1 is acetylated at lysines 430 and 437. TSA and NAM increase the binding of Beclin 1 to Rubicon. Immunoprecipitation of indicated Beclin 1-binding partners with ectopically expressed Flag-Beclin 1 in HEK293T cells treated with TSA and NAM. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/ncomms8215), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: UVRAG Antibody [NBP1-18885] - Section of human colon carcinoma. Antibody: Affinity purified rabbit anti- UVRAG used at a dilution of 1:200 (1ug/ml). Detection: DAB
Western Blot: UVRAG Antibody [NBP1-18885] - Whole cell lysate from HeLa and 293T cells. UVRAG was also immunoprecipitated by rabbit anti-UVRAG antibody NBP1-18884.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AP3B1 Antibody
NBP1-89228
Immunocytochemistry/Immunofluorescence: AP3B1 Antibody [NBP1-89228] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: AP3B1 Antibody [NBP1-89228] - Staining of human rectum shows cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ATG10 Recombinant
Protein Antigen
NBP2-38524PEP
ATG10 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ATG10 Protein (NBP2-38524PEP) (0)

There are no publications for ATG10 Protein (NBP2-38524PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG10 Protein (NBP2-38524PEP) (0)

There are no reviews for ATG10 Protein (NBP2-38524PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATG10 Protein (NBP2-38524PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional ATG10 Products

Bioinformatics Tool for ATG10 Protein (NBP2-38524PEP)

Discover related pathways, diseases and genes to ATG10 Protein (NBP2-38524PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATG10 Protein (NBP2-38524PEP)

Discover more about diseases related to ATG10 Protein (NBP2-38524PEP).
 

Pathways for ATG10 Protein (NBP2-38524PEP)

View related products by pathway.

PTMs for ATG10 Protein (NBP2-38524PEP)

Learn more about PTMs related to ATG10 Protein (NBP2-38524PEP).
 

Research Areas for ATG10 Protein (NBP2-38524PEP)

Find related products by research area.

Blogs on ATG10.

Check out the latest blog posts on ATG10.

  Read full blog post.
From Then ‘till Now: The History of Autophagy and Cancer Research
By Christina Towers, PhD. The fundamental process that cells use to degrade damaged cytoplasmic material and recycle nutrients is called autophagy.  This term was first coined by the Belgium biochemist Christian de...  Read full blog post.
ATG12 - a ubiquitin-like protein essential for autophagosome assembly
Atg12 is a ubiquitin-like protein that plays an essential role in cellular homeostasis by regulating the degradation and recycling of cytoplasmic organelles and macromolecules. Atg12 is one of two ubiquitin-like protein systems that is required du...  Read full blog post.

Customers Who Bought This Also Bought

Western Blot: LC3A Antibody [NB100-2331] - High autophagosome concentration is consumed during early immortalized human mesenchymal stem cell differentiation. Immortalized human mesenchymal stem cells were differentiated under osteogenic conditions (see Materials and methods) and assayed for changes in LC3I and LC3II during a 72-hour window. Cells were differentiated under standard conditions (top) or with addition of 5 uM rapamycin (middle) or 5 nM bafilomycin (bottom) for the first 3 hours of differentiation to modulate autophagy. Immunoblots were performed for LC3 at the indicated time points to assess autophagosome degradation via relative changes in LC3II (lower band; 17 kDa). Studies were repeated three times with similar trends seen consistently. Image collected and cropped by CiteAb from the following publication (http://stemcellres.com/content/5/6/140), licensed under a CC-BY licence.
LC3A Antibody
NB100-2331
Western Blot: ATG5 Antibody [NB110-53818] - Western blot analysis in mouse wildtype ES cell lysate (Lane 1) using NB110-53818. Lane 2 is a mouse ATG5 KO ES cell lysate (negative control). Atg5-/- ES cells from Dr. Noboru Mizushima [Mizushima, N. et al. J. Cell Biol. 152 (2001)] Photo courtesy of Dr. Beth Levine, UT Southwestern Medical Center.
ATG5 Antibody
NB110-53818

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATG10 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ATG10