Home » ATF5 » ATF5 Antibodies » ATF5 Antibody (4G5)

ATF5 Antibody (4G5)

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: ATF5 Antibody (4G5) [H00022809-M07] - Analysis of monoclonal antibody to ATF5 on formalin-fixed paraffin-embedded human cerebellum. Antibody concentration 3 ug/ml
Immunohistochemistry-Paraffin: ATF5 Antibody (4G5) [H00022809-M07] - Analysis of monoclonal antibody to ATF5 on formalin-fixed paraffin-embedded human cerebellum. Antibody concentration 3 ug/ml
Sandwich ELISA: ATF5 Antibody (4G5) [H00022809-M07] - Detection limit for recombinant GST tagged ATF5 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
4G5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ATF5 Antibody (4G5) Summary

Immunogen
ATF5 (AAH05174.1, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASLLKKELEQMEDFFLDAPLLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPVLDTLDLLAIYCRNEAGQEEVGMPPLPPPQQPPPPSPPQPSRLAPY
Specificity
ATF5 - activating transcription factor 5 (4G5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATF5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATF5 Antibody (4G5)

  • activating transcription factor 5FLJ34666
  • ATFXHMFN0395
  • cAMP-dependent transcription factor ATF-5
  • cyclic AMP-dependent transcription factor ATF-5
  • Transcription factor ATFx

Background

Transcriptional activator which binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters and blocks the differentiation of neuroprogenitor cells into neurons. Its transcriptional activity is enhanced by CCND3 and slightly inhibited by CDK4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

GDNF [Unconjugated]
212-GD/CF
Recombinant Human GDNF (Catalog # 212‑GD/CF) induces SH-SY5Y human neuroblastoma cell proliferation in the presence of Recombinant Human GFR alpha ‑1 Fc Chimera (Catalog # 714‑GR). The activity is approximately 9-fold greater than the top competitor's GDNF.
1 μg/lane of Recombinant Human GDNF was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing single bands at 17 kDa and 34 kDa, respectively.
(172 Publications)
Species: Hu
Applications: Bind, BA
u-Plasminogen
Activator/Urokinase [ ...
1310-SE
Recombinant Human u-Plasminogen Activator/Urokinase (Catalog # 1310-SE) is measured by its ability to cleave a peptide substrate,N-carbobenzyloxy-Gly-Gly-Arg-7-amido-4-methylcoumarin (Z-GGR-AMC).
(11 Publications)
Species: Hu
Applications: EnzAct
EGR1 Antibody (6E8)
H00001958-M03
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of EGR1 expression in transfected 293T cell line by EGR1 monoclonal antibody (M03), clone 6E8. Lane 1: EGR1 transfected lysatE (59.73 KDa). Lane 2: Non-transfected lysate.
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - EGR1 monoclonal antibody (M03), clone 6E8. Western Blot analysis of EGR1 expression in Raw 264.7.
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - EGR1 monoclonal antibody (M03), clone 6E8. Western Blot analysis of EGR1 expression in PC-12.
(3 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ATF4 Antibody
(SD20-92)
NBP2-67766
Flow Cytometry: ATF4 Antibody (SD20-92) [NBP2-67766] - Analysis of Hela cells with ATF4 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ATF4 Antibody (SD20-92) [NBP2-67766] - Staining ATF4 in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
Western Blot: ATF4 Antibody (SD20-92) [NBP2-67766] - Analysis of ATF4 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature. Positive control: Lane 1: HeLa cell lysateLane 2: PC-12 cell lysate Lane 3: HL-60 cell lysate Lane 4: K562 cell lysateLane 5: human lung carcinoma tissue lysate.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Brown arrow= IBa1 positive cells, Green arrow= mTOR positive cells, Black arrow= mTOR and IBA1 positive cells. IHC-P Image submitted by a verified customer review.
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Rapamycin reduces mTOR phosphorylation induced by TII. Whole-cell lysates were prepared from astrocytes activated with TII for 2 h. 10 nM Rapamycin was added at the beginning of the experiment and equal amounts of protein were analyzed by western blot for phosphorylated mTOR kinase (p-mTOR) (upper gel) and consequently for beta-actin (lower gel). Image collected and cropped by CiteAb from the following publication (http://jneuroinflammation.biomedcentral.com/articles/10.1186/1742-2094-8-1), licensed under a CC-BY licence.
N/A: TOR/mTOR [p Ser2448] Antibody [NB600-607]
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
CREB [p Ser133]
[Biotin]
DYC2510-2
A lysate prepared from HeLa human cervical epithelial carcinoma cells treated with 200 nM PMA for 20 minutes was analyzed with this DuoSet IC ELISA. The Human/Mouse/Rat Phospho-CREB (S133) DuoSet IC Detection Antibody was either untreated (no peptide) or pre-incubated with a phosphopeptide containing the CREB S133 phosphorylation site, a phosphopeptide containing the GSK-3 beta S9 phosphorylation site, a phosphopeptide containing the c-Jun S63 phosphorylation site, or a phosphopeptide containing the Raf1 S338 phosphorylation site. Peptides were used at 40 ng/mL. Only the phosphopeptide containing the CREB S133 phosphorylation site blocks the signal, indicating that the DuoSet IC ELISA is specific for CREB phosphorylation at S133.
Lysates prepared from HeLa human cervical epithelial carcinoma cells either uninduced or induced with 200 nM PMA for the indicated times were quantified with this DuoSet IC ELISA. The same lysates were also immunoblotted (inset) with either Anti-Human Phospho-CREB (S133) (Catalog # AF2510) or Anti-Human CREB (Catalog # AF2989) Polyclonal Antibodies. The DuoSet IC ELISA results correlate well with the amounts of phosphorylated CREB detected by Western blot. The immunoblot with anti-CREB antibody indicates that total levels of human CREB remained constant during incubation with PMA.The quantification of phosphorylated CREB with this DuoSet IC ELISA was also determined using cells pretreated with two concentrations of the MEK inhibitor U0126, which indirectly inhibits phosphorylation of CREB at S133.
HeLa human cervical epithelial carcinoma cells were untreated or treated with 200 nM PMA for 20 minutes, either with or without U0126 at the indicated concentrations. Cells were lysed and CREB phosphorylated at S133 was quantified with this DuoSet IC ELISA. The same lysates were also immunoblotted (inset) with either anti-phospho-CREB (S133) or anti-CREB antibodies. The DuoSet IC ELISA results correlate well with the amounts of phosphorylated CREB detected by Western blot. The immunoblot with anti-CREB antibody indicates that total levels of human CREB remained constant during the various treatments.The Phospho-CREB (S133) DuoSet IC ELISA also quantifies phosphorylated CREB levels in mouse and rat cell lysates.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - EA reduced MPP+-induced dopaminergic neuronal apoptosis by increasing BDNF (brain-derived neurotrophic factor) expression and further Akt phosphorylation in the rat substantia nigra. Eight days after MPP+ administration, our Western blot results (MAB7566) show that MPP+ treatment reduced tyrosine hydroxylase and Bcl-2 expression in the ipsilateral side of the rat substantia nigra (SN), but not in the contralateral side. EA stimulation (50 Hz) enhanced mature BDNF, tyrosine hydroxylase, and Bcl-2 expression in the MPP+-treated ipsilateral side. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/1422-0067/18/9/1846), licensed under a CC-BY licence.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 using this antibody at 1:2000, 20 ug/protein was loaded per lane. (1) Human Jurkat T cells. (2) Human RS11 lymphoma cells. (3-6) Human breast cancer cases. Patient sample in lane 5 lacked detectible Bcl-2 expression.
(2 Reviews)
(16 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
ATF2 [p Thr69]
Antibody
NB100-81798
Western Blot: ATF2 [p Thr69] Antibody [NB100-81798] - Human U251 glioma cell line, whole cell lysates. Cells have been treated with JNK and p38 inhibitors. WB image submitted by a verified customer review.
Immunohistochemistry: ATF2 [p Thr69] Antibody [NB100-81798] - Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue using ATF-2 (phospho-Thr69 or 51) antibody NB100-81798.
Western Blot: ATF2 [p Thr69] Antibody [NB100-81798] - Analysis of extracts from 3T3 cells untreated or treated with Anisomycin using ATF2 (Phospho-Thr69 or 51) antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NPM1 Antibody -
BSA Free
NB110-61646
Immunocytochemistry/Immunofluorescence: Nucleophosmin Antibody [NB110-61646] - Nucleophosmin localization by immunofluorescence in OCI-AML3 cells.
Immunocytochemistry/Immunofluorescence: Nucleophosmin Antibody [NB110-61646] - Nucleophosmin localization by immunofluorescence in HL-60 cells (negative control).
Western Blot: Nucleophosmin Antibody [NB110-61646] - Detection of mutant Nucleophosmin in OCI-AML3 lysates.
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
HspA4 Antibody
(SD0861)
NBP2-67817
Flow Cytometry: HspA4 Antibody (SD0861) [NBP2-67817] - Analysis of Hela cells with HSPA4 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: HspA4 Antibody (SD0861) [NBP2-67817] - Staining HSPA4 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: HspA4 Antibody (SD0861) [NBP2-67817] - Staining HSPA4 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Complement C6
Antibody
NBP1-91803
Western Blot: Complement C6 Antibody [NBP1-91803] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: Complement C6 Antibody [NBP1-91803] - Staining of human prostate shows strong granular cytoplasmic and membranous positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P, WB
PSMA7 Antibody
(1A10-3G12)
H00005688-M01
Western Blot: PSMA7 Antibody (1A10-3G12) [H00005688-M01] - Analysis of PSMA7 expression in transfected 293T cell line by PSMA7 monoclonal antibody (M01), clone 1A10-3G12.Lane 1: PSMA7 transfected lysate (Predicted MW: 27.9 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: PSMA7 Antibody (1A10-3G12) [H00005688-M01] - Analysis of monoclonal antibody to PSMA7 on HeLa cell. Antibody concentration 1 ~ 10 ug/ml.
Immunohistochemistry-Paraffin: PSMA7 Antibody (1A10-3G12) [H00005688-M01] - Analysis of monoclonal antibody to PSMA7 on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. Antibody concentration 5 ug/ml.
(1 Review)
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen: Tyrosine Hydroxylase Antibody [NB300-109] - 10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the mushroom body. All panels show a right brain hemisphere (dorsal to the top, medial to the right), except panels M-O (posterior to the top). Tyrosine hydroxylase (TH) immunoreactivity is shown in magenta (A, D, G, J, M) and synapsin immunoreactivity in green (B, E, H, K, N). Corresponding merged images in C, F, I, L, O. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
(7 Reviews)
(177 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
DISC1 Antibody
NB110-40773
Immunohistochemistry: DISC1 Antibody [NB110-40773] - Staining of DISC1 in human brain neurons and neuropil at 2.5ug/ml. 40X.
Immunocytochemistry/Immunofluorescence: DISC1 Antibody [NB110-40773] - DISC1 antibody was tested in PC-12 cells at 1:100 with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 549 (red).
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
CEBP gamma Antibody
NBP1-89742
Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742] - Staining of human small intestine shows high expression.
Immunohistochemistry-Paraffin: CEBP gamma Antibody [NBP1-89742] - Staining in human small intestine and pancreas tissues using anti-CEBPG antibody. Corresponding CEBPG RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western blot shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery. PVDF membrane was probed with 0.5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-c‑Jun (S63) at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
c‑Junphosphorylated at S63 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line treated with Anisomycin using Rabbit Anti-HumanPhospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) at 1 μg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery, loaded at 0.2 mg/mL. A specific band was detected for Phospho-c‑Jun (S63) at approximately 49 kDa (as indicated) using 5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
TRAF3IP1 Antibody
NBP2-14847
Immunohistochemistry-Paraffin: TRAF3IP1 Antibody [NBP2-14847] - analysis of TRAF3IP1. Human testis probed with TRAF3IP1 antibody at 5 ug/ml.
Species: Hu, Pm
Applications: IHC, IHC-P
CNTF [Unconjugated]
257-NT/CF
1 μg/lane of Recombinant Human CNTF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 26 kDa.
Recombinant Human CNTF (Catalog #257‑NT/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.03-0.18 μg/mL.
(44 Publications)
Species: Hu
Applications: BA
GFAP Antibody
NB300-141
Immunohistochemistry: GFAP Antibody [NB300-141] - Analysis of a rat cerebellum section stained with rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green and mouse monoclonal antibody to MeCP2, dilution 1:500, in red. The blue is DAPI staining of nuclear DNA. Following transcardial perfusion of rat with 4% paraformaldehyde, brain was post fixed for 1 hour, cut to 45 uM, and free-floating sections were stained with above antibodies. The GFAP antibody stains the network of astrocytic cells and the processes of Bergmann glia in the molecular layer. The MeCP2 antibody specifically labels nuclei of certain neurons.
Western Blot: GFAP Antibody [NB300-141] - Analysis of different tissue lysates using rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord. Strong band at about 50 kDa corresponds to the major isotype of the GFAP protein. Smaller isotypes and proteolytic fragments of GFAP are also detected on the blot.
Western Blot: GFAP Antibody [NB300-141] - Analysis of Rat brain lysate. Antibody at 1:5000. Specific band running with an apparent SDS-PAGE molecular weight of ~50 kDa corresponds to rodent GFAP was observed.
(12 Reviews)
(83 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
LZTS1 Antibody
NBP1-83908
Western Blot: LZTS1 Antibody [NBP1-83908] - Analysis in control (vector only transfected HEK293T lysate) and LZTS1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: LZTS1 Antibody [NBP1-83908] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: LZTS1 Antibody [NBP1-83908] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ATF5 Antibody (H00022809-M07) (0)

There are no publications for ATF5 Antibody (H00022809-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATF5 Antibody (H00022809-M07) (0)

There are no reviews for ATF5 Antibody (H00022809-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATF5 Antibody (H00022809-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATF5 Products

Bioinformatics Tool for ATF5 Antibody (H00022809-M07)

Discover related pathways, diseases and genes to ATF5 Antibody (H00022809-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATF5 Antibody (H00022809-M07)

Discover more about diseases related to ATF5 Antibody (H00022809-M07).
 

Pathways for ATF5 Antibody (H00022809-M07)

View related products by pathway.

PTMs for ATF5 Antibody (H00022809-M07)

Learn more about PTMs related to ATF5 Antibody (H00022809-M07).
 

Research Areas for ATF5 Antibody (H00022809-M07)

Find related products by research area.

Blogs on ATF5

There are no specific blogs for ATF5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATF5 Antibody (4G5) and receive a gift card or discount.


Bioinformatics

Gene Symbol ATF5
Entrez
Uniprot