ATF5 Antibody (4G5)

Images

 
Immunohistochemistry-Paraffin: ATF5 Antibody (4G5) [H00022809-M07] - Analysis of monoclonal antibody to ATF5 on formalin-fixed paraffin-embedded human cerebellum. Antibody concentration 3 ug/ml
Sandwich ELISA: ATF5 Antibody (4G5) [H00022809-M07] - Detection limit for recombinant GST tagged ATF5 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
4G5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATF5 Antibody (4G5) Summary

Immunogen
ATF5 (AAH05174.1, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASLLKKELEQMEDFFLDAPLLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPVLDTLDLLAIYCRNEAGQEEVGMPPLPPPQQPPPPSPPQPSRLAPY
Specificity
ATF5 - activating transcription factor 5 (4G5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATF5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATF5 Antibody (4G5)

  • activating transcription factor 5FLJ34666
  • ATFXHMFN0395
  • cAMP-dependent transcription factor ATF-5
  • cyclic AMP-dependent transcription factor ATF-5
  • Transcription factor ATFx

Background

Transcriptional activator which binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters and blocks the differentiation of neuroprogenitor cells into neurons. Its transcriptional activity is enhanced by CCND3 and slightly inhibited by CDK4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

212-GD/CF
Species: Hu
Applications: Bind, BA
1310-SE
Species: Hu
Applications: EnzAct
H00001958-M03
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-67766
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-81798
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-61646
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-91803
Species: Hu
Applications: IHC, IHC-P, WB
H00005688-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89742
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-14847
Species: Hu, Pm
Applications: IHC, IHC-P
257-NT/CF
Species: Hu
Applications: BA
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-83908
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ATF5 Antibody (H00022809-M07) (0)

There are no publications for ATF5 Antibody (H00022809-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATF5 Antibody (H00022809-M07) (0)

There are no reviews for ATF5 Antibody (H00022809-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATF5 Antibody (H00022809-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATF5 Products

Bioinformatics Tool for ATF5 Antibody (H00022809-M07)

Discover related pathways, diseases and genes to ATF5 Antibody (H00022809-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATF5 Antibody (H00022809-M07)

Discover more about diseases related to ATF5 Antibody (H00022809-M07).
 

Pathways for ATF5 Antibody (H00022809-M07)

View related products by pathway.

PTMs for ATF5 Antibody (H00022809-M07)

Learn more about PTMs related to ATF5 Antibody (H00022809-M07).
 

Research Areas for ATF5 Antibody (H00022809-M07)

Find related products by research area.

Blogs on ATF5

There are no specific blogs for ATF5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATF5 Antibody (4G5) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATF5
Entrez
Uniprot