ATF3 Antibody (6G11)

Images

 
Western Blot: ATF3 Antibody (6G11) [H00000467-M07] - Analysis of ATF3 expression in Hela S3 NE (Cat # L013V3).
Sandwich ELISA: ATF3 Antibody (6G11) [H00000467-M07] - Detection limit for recombinant GST tagged ATF3 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATF3 Antibody (6G11) Summary

Immunogen
ATF3 (AAH06322, 1 a.a. - 181 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Specificity
ATF3 (6G11)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATF3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATF3 Antibody (6G11)

  • activating transcription factor 3cAMP-dependent transcription factor ATF-3
  • ATF3deltaZip2
  • ATF3deltaZip2c
  • ATF3deltaZip3
  • cyclic AMP-dependent transcription factor ATF-3

Background

Activating transcription factor 3 is a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-85457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56530
Species: Hu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
MAB5526
Species: Hu, Mu
Applications: WB

Publications for ATF3 Antibody (H00000467-M07) (0)

There are no publications for ATF3 Antibody (H00000467-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATF3 Antibody (H00000467-M07) (0)

There are no reviews for ATF3 Antibody (H00000467-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATF3 Antibody (H00000467-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATF3 Products

Bioinformatics Tool for ATF3 Antibody (H00000467-M07)

Discover related pathways, diseases and genes to ATF3 Antibody (H00000467-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATF3 Antibody (H00000467-M07)

Discover more about diseases related to ATF3 Antibody (H00000467-M07).
 

Pathways for ATF3 Antibody (H00000467-M07)

View related products by pathway.

PTMs for ATF3 Antibody (H00000467-M07)

Learn more about PTMs related to ATF3 Antibody (H00000467-M07).

Blogs on ATF3.

Multifaceted Roles of Matrix Metalloproteinase-2 (MMP2) in Normal and Disease State
MMP2 is a 72 kDa enzymatic protein and it belongs to matrix metalloproteinases (MMPs), a heterogenous family of zinc/calcium-dependent TIMPs (tissue inhibitors of matrix metalloproteinases) regulated matrix-degrading endopeptidases which are class...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATF3 Antibody (6G11) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATF3
Entrez
OMIM
Uniprot