ATE1 Antibody (2B6) - Azide and BSA Free

Western Blot: ATE1 Antibody (2B6) [H00011101-M01] - ATE1 monoclonal antibody (M01), clone 2B6. Analysis of ATE1 expression in Jurkat.

Immunocytochemistry/Immunofluorescence: ATE1 Antibody (2B6) [H00011101-M01] - Analysis of monoclonal antibody to ATE1 on HeLa cell . Antibody concentration 10 ug/ml.

Western Blot: ATE1 Antibody (2B6) [H00011101-M01] - Analysis of ATE1 expression in transfected 293T cell line by ATE1 monoclonal antibody (M01), clone 2B6.Lane 1: ATE1 transfected lysate (Predicted MW: 59 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: ATE1 Antibody (2B6) [H00011101-M01] - Detection limit for recombinant GST tagged ATE1 is 3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 2B6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATE1 Antibody (2B6) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ATE1 Antibody (2B6) - Azide and BSA Free (H00011101-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ATE1 (NP_001001976, 1 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPS
• Specificity: arginyltransferase 1
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATE1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATE1 Antibody (2B6) - Azide and BSA Free

• Arginine-tRNA--protein transferase 1
• arginyltransferase 1MGC26724
• arginyl-tRNA--protein transferase 1
• arginyl-tRNA-protein transferase
• EC 2.3.2.8
• R-transferase 1

Background

This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in two transcript variants encoding distinct isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATE1
• Entrez:
  • 11101(Human)
• Uniprot:
  • NP_001001976(Human)