![Immunohistochemistry-Paraffin: Aspartate Aminotransferase Antibody [NBP2-57518] - Staining in human heart muscle and lymph node tissues using anti-GOT1 antibody. Corresponding GOT1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Aspartate-Aminotransferase-Antibody-Immunohistochemistry-Paraffin-NBP2-57518-img0006.jpg "Immunohistochemistry-Paraffin: Aspartate Aminotransferase Antibody [NBP2-57518] - Staining in human heart muscle and lymph node tissues using anti-GOT1 antibody. Corresponding GOT1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Aspartate Aminotransferase Antibody - BSA Free (NBP2-57518) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Aspartate Aminotransferase Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ |
| Predicted Species | Mouse (96%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GOT1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-57518 | Applications | Species |
|---|---|---|
| Ma EH, Dahabieh MS, DeCamp LM et al. 13 C metabolite tracing reveals glutamine and acetate as critical in vivo fuels for CD8 + T cells bioRxiv : the preprint server for biology 2023-06-11 [PMID: 37333111] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for Aspartate Aminotransferase Antibody (NBP2-57518)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GOT1 |
![Western Blot: Aspartate Aminotransferase Antibody [NBP2-57518] - Analysis using Anti-GOT1 antibody NBP2-57518 (A) shows similar pattern to independent antibody NBP2-55813 (B).](http://images.novusbio.com/fullsize/Aspartate-Aminotransferase-Antibody-Western-Blot-NBP2-57518-img0007.jpg "Western Blot: Aspartate Aminotransferase Antibody [NBP2-57518] - Analysis using Anti-GOT1 antibody NBP2-57518 (A) shows similar pattern to independent antibody NBP2-55813 (B).")
![Immunocytochemistry/Immunofluorescence: Aspartate Aminotransferase Antibody [NBP2-57518] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Aspartate-Aminotransferase-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57518-img0001.jpg "Immunocytochemistry/Immunofluorescence: Aspartate Aminotransferase Antibody [NBP2-57518] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Aspartate Aminotransferase Antibody [NBP2-57518] - Staining of human heart muscle shows high expression.](http://images.novusbio.com/fullsize/Aspartate-Aminotransferase-Antibody-Immunohistochemistry-Paraffin-NBP2-57518-img0004.jpg "Immunohistochemistry-Paraffin: Aspartate Aminotransferase Antibody [NBP2-57518] - Staining of human heart muscle shows high expression.")
![Immunohistochemistry-Paraffin: Aspartate Aminotransferase Antibody [NBP2-57518] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/Aspartate-Aminotransferase-Antibody-Immunohistochemistry-Paraffin-NBP2-57518-img0005.jpg "Immunohistochemistry-Paraffin: Aspartate Aminotransferase Antibody [NBP2-57518] - Staining of human lymph node shows low expression as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")