Aspartate Aminotransferase Antibody


Western Blot: Aspartate Aminotransferase Antibody [NBP2-57518] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: Aspartate Aminotransferase Antibody [NBP2-57518] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Aspartate Aminotransferase Antibody [NBP2-57518] - Staining in human heart muscle and lymph node tissues using anti-GOT1 antibody. Corresponding GOT1 RNA-seq data are presented for the more
Immunohistochemistry-Paraffin: Aspartate Aminotransferase Antibody [NBP2-57518] - Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Aspartate Aminotransferase Antibody [NBP2-57518] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: Aspartate Aminotransferase Antibody [NBP2-57518] - Staining of human lymph node shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Aspartate Aminotransferase Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ
Specificity of human Aspartate Aminotransferase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (91%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
Aspartate Aminotransferase Lysate (NBP2-66128)
Control Peptide
Aspartate Aminotransferase Recombinant Protein Antigen (NBP2-57518PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Aspartate Aminotransferase Antibody

  • aspartate aminotransferase, cytoplasmic
  • EC
  • GIG18
  • Glutamate oxaloacetate transaminase 1
  • glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)
  • growth-inhibiting protein 18
  • Transaminase A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IB, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, GP, Ze
Applications: IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Aspartate Aminotransferase Antibody (NBP2-57518) (0)

There are no publications for Aspartate Aminotransferase Antibody (NBP2-57518).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aspartate Aminotransferase Antibody (NBP2-57518) (0)

There are no reviews for Aspartate Aminotransferase Antibody (NBP2-57518). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aspartate Aminotransferase Antibody (NBP2-57518) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Aspartate Aminotransferase Antibody (NBP2-57518)

Discover related pathways, diseases and genes to Aspartate Aminotransferase Antibody (NBP2-57518). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aspartate Aminotransferase Antibody (NBP2-57518)

Discover more about diseases related to Aspartate Aminotransferase Antibody (NBP2-57518).

Pathways for Aspartate Aminotransferase Antibody (NBP2-57518)

View related products by pathway.

PTMs for Aspartate Aminotransferase Antibody (NBP2-57518)

Learn more about PTMs related to Aspartate Aminotransferase Antibody (NBP2-57518).

Research Areas for Aspartate Aminotransferase Antibody (NBP2-57518)

Find related products by research area.

Blogs on Aspartate Aminotransferase

There are no specific blogs for Aspartate Aminotransferase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Aspartate Aminotransferase Antibody and receive a gift card or discount.


Gene Symbol GOT1