Asparagine synthetase Recombinant Protein Antigen

Images

 
There are currently no images for Asparagine synthetase Recombinant Protein Antigen (NBP2-55125PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Asparagine synthetase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASNS.

Source: E. coli

Amino Acid Sequence: QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ASNS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55125.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Asparagine synthetase Recombinant Protein Antigen

  • ASNS
  • ASNSD
  • asparagine synthetase (glutamine-hydrolyzing)
  • asparagine synthetase [glutamine-hydrolyzing]
  • asparagine synthetase
  • Cell cycle control protein TS11
  • EC 6.3.5.4
  • Glutamine Dependent Asparagine Synthetase
  • Glutamine-dependent asparagine synthetase
  • TS11 Cell Cycle Control Protein
  • TS11

Background

Asparagine synthetase (AS) is a housekeeping enzyme responsible for the production of asparagine from aspartate and glutamine. Most mammalian cells express AS and regulate the level of activity in response to the concentration of asparagine in the medium. Certain tumor cells in contrast, exhibit little or no AS activity and rely on the surrounding medium as a source of exogenous asparagines (1). Therefore tumor cells may be selectively killed by a chemotherapeutic drug using asparaginase. This approach has been exploited in the treatment of certain cancers like childhood acute lymphoblastic leukemia (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87444
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-67766
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-85816
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13640
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
NB100-56398
Species: Hu
Applications: ICC/IF, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP1-88868
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89766
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NBP3-35470
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-04266
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB

Publications for Asparagine synthetase Recombinant Protein Antigen (NBP2-55125PEP) (0)

There are no publications for Asparagine synthetase Recombinant Protein Antigen (NBP2-55125PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Asparagine synthetase Recombinant Protein Antigen (NBP2-55125PEP) (0)

There are no reviews for Asparagine synthetase Recombinant Protein Antigen (NBP2-55125PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Asparagine synthetase Recombinant Protein Antigen (NBP2-55125PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Asparagine synthetase Products

Research Areas for Asparagine synthetase Recombinant Protein Antigen (NBP2-55125PEP)

Find related products by research area.

Blogs on Asparagine synthetase

There are no specific blogs for Asparagine synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Asparagine synthetase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ASNS