Asparaginase Antibody - BSA Free

Immunohistochemistry-Paraffin: Asparaginase Antibody [NBP2-49617] - Staining in human kidney and pancreas tissues using anti-ASPG antibody. Corresponding ASPG RNA-seq data are presented for the same tissues.

Western Blot: Asparaginase Antibody [NBP2-49617] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissue

Immunohistochemistry-Paraffin: Asparaginase Antibody [NBP2-49617] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: Asparaginase Antibody [NBP2-49617] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Asparaginase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Asparaginase Antibody - BSA Free (NBP2-49617) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VLVPGTGLAAILRTLPMFHDEEHARARGLSEDTLVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASPG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Asparaginase Recombinant Protein Antigen (NBP2-49617PEP)

Reactivity Notes

Mouse (80%), Rat (80%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Asparaginase Antibody - BSA Free

• AnsA
• AnsB
• Asparaginase
• ASPG
• C14orf76
• Colaspase
• Cytoplasmic asparaginase I
• L ASNase I
• L ASNase II
• L asparaginase 1
• L asparaginase 2
• L asparaginase I
• L asparaginase II precursor
• L asparaginase II
• L asparagine amidohydrolase I
• L asparagine amidohydrolase II

Background

Asparaginase is an enzyme purified from E. coli and Erwinia carotovora. It acts by deaminating extracellular L asparagine, an amino acid that appears to be essential for protein synthesis by some tumour cells which are unable to synthesise asparagine. Asparaginase from Erwinia carotovora is serologically and biochemically distinct from asparaginase from E. coli, although its antineoplastic activity and toxicity is similar. Asparaginase is usually considered to be cell cycle phase nonspecific, but it may block some cells in G1 or S phase. Asparaginase reduces cellular and humoral immunity. E.coli contains two L asparaginase isoenzymes: L asparaginase I, a low affinity enzyme located in the cytoplasm, and L asparaginase II, a high affinity secreted enzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ASPG