We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ASH2L Recombinant Protein Antigen

Images

 
There are currently no images for ASH2L Protein (NBP1-88858PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ASH2L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASH2L.

Source: E. coli

Amino Acid Sequence: TTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ASH2L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88858.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ASH2L Recombinant Protein Antigen

  • ash2 (absent, small, or homeotic)-like (Drosophila)
  • ASH2
  • ASH2L1ash2 (absent, small, or homeotic, Drosophila, homolog)-like
  • ASH2L2ASH2-like protein
  • Bre2
  • set1/Ash2 histone methyltransferase complex subunit ASH2

Background

ASH2L is a component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. May function as a transcriptional regulator. May play a rol

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NB600-252
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, ICC/IF, IHC,  IHC-P, IP, WB
AF5810
Species: Hu, Mu
Applications: IHC, WB
NB100-558
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB
NB100-215
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, Simple Western, WB
NB100-68209
Species: Hu
Applications: IP, KD, WB
NB100-93290
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP3-27690
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NB200-335
Species: Hu
Applications: IHC,  IHC-P, IP, WB
AF5738
Species: Hu
Applications: ICC, KO, Simple Western, WB
NBP1-91848
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-89495
Species: Hu
Applications: IHC,  IHC-P, WB
AF2780
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
AF2567
Species: Mu
Applications: IHC, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP1-88858PEP
Species: Hu
Applications: AC

Publications for ASH2L Protein (NBP1-88858PEP) (0)

There are no publications for ASH2L Protein (NBP1-88858PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASH2L Protein (NBP1-88858PEP) (0)

There are no reviews for ASH2L Protein (NBP1-88858PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ASH2L Protein (NBP1-88858PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ASH2L Products

Research Areas for ASH2L Protein (NBP1-88858PEP)

Find related products by research area.

Blogs on ASH2L

There are no specific blogs for ASH2L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ASH2L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ASH2L