ASB13 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ASB13 Antibody [NBP2-57501] - Staining of human cell line HEK 293 shows localization to nucleus & the Golgi apparatus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASB13 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNI
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASB13
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ASB13 Recombinant Protein Antigen (NBP2-57501PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ASB13 Antibody

  • ankyrin repeat and SOCS box containing 13
  • ankyrin repeat and SOCS box protein 13
  • ankyrin repeat and SOCS box-containing 13
  • ankyrin repeat domain-containing SOCS box protein Asb-13
  • ASB-13
  • FLJ13134
  • MGC19879

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-78626
Species: Hu
Applications: ChIP, Flow, IF, IHC, IHC-P, IP, WB
NBP2-01245
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87724
Species: Hu
Applications: IHC, IHC-P, WB
H00001018-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-47358
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90171
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-65125
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB120-3216
Species: Hu, Mu
Applications: IF, IHC, IHC-P, IP, WB
H00000894-B01P
Species: Hu, Rt
Applications: WB
NBP2-67344
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB
NB7276
Species: Ch
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00002629-M01
Species: Hu, Pl
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF5525
Species: Hu
Applications: IHC, WB
NBP2-67800
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
NBP2-67717
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB600-594
Species: Bv, Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Publications for ASB13 Antibody (NBP2-57501) (0)

There are no publications for ASB13 Antibody (NBP2-57501).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASB13 Antibody (NBP2-57501) (0)

There are no reviews for ASB13 Antibody (NBP2-57501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ASB13 Antibody (NBP2-57501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ASB13 Products

Bioinformatics Tool for ASB13 Antibody (NBP2-57501)

Discover related pathways, diseases and genes to ASB13 Antibody (NBP2-57501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASB13 Antibody (NBP2-57501)

Discover more about diseases related to ASB13 Antibody (NBP2-57501).
 

Pathways for ASB13 Antibody (NBP2-57501)

View related products by pathway.

Research Areas for ASB13 Antibody (NBP2-57501)

Find related products by research area.

Blogs on ASB13

There are no specific blogs for ASB13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASB13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASB13