ASB1 Antibody - BSA Free

Western Blot: ASB1 Antibody [NBP2-82680] - WB Suggested Anti-ASB1 Antibody. Titration: 1.0 ug/ml. Positive Control: OVCAR-3 Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ASB1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ASB1 Antibody - BSA Free (NBP2-82680) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of ASB1. Peptide sequence: PGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPESRGRRKVDPEA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ASB1 Antibody - BSA Free

• ankyrin repeat and SOCS box containing 1
• ankyrin repeat and SOCS box protein 1
• ASB-1ankyrin repeat and SOCS box-containing 1
• KIAA1146
• MGC11165

Background

ASB1 (ankyrin repeat and SOCS box-containing 1) protein is a 37 kD member of the ASB family. This protein is believed to be involved in protein stability by virtue of its SOCS box motif acting as an adaptor for SOCS box-containing proteins and/or their protein partners being targeted for proteasomal degradation. The Poly6149 antibody has been shown to be useful for Western blotting of the human and mouse ASB1 protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ASB1