ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (5E3) - Azide and BSA Free Summary
| Immunogen |
NAAA (NP_055250, 36 a.a. ~ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCD |
| Localization |
Lysosome |
| Specificity |
ASAHL - N-acylsphingosine amidohydrolase (acid ceramidase)-like |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
NAAA |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (5E3) - Azide and BSA Free
Background
ASAHL (N-acylsphingosine amidohydrolase (acid ceramidase)-like) encodes an N-acylethanolamine-hydrolyzing enzyme which is highly similar to acid ceramidase. It degrades bioactive fatty acid amides to their corresponding acids and also exhibits weak hydrolytic activity against the ceramides N-lauroylsphingosine and N-palmitoylsphingosine.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P
Publications for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (H00027163-M01) (0)
There are no publications for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (H00027163-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (H00027163-M01) (0)
There are no reviews for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (H00027163-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (H00027163-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Products
Blogs on ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase