ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4) - Azide and BSA Free

Western Blot: ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4) [H00027163-M02] - Analysis of NAAA expression in transfected 293T cell line by NAAA monoclonal antibody (M02), clone 3F4.Lane 1: NAAA transfected lysate(22 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4) [H00027163-M02] - Analysis of NAAA transfected lysate using anti-NAAA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NAAA MaxPab rabbit polyclonal antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 3F4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4) - Azide and BSA Free Summary

• Immunogen: NAAA (NP_055250, 36 a.a. ~ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCD
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NAAA
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4) - Azide and BSA Free

• Acid ceramidase-like protein
• ASAHL
• ASAH-like protein
• EC 3.5.1.-
• NAAA
• N-acylethanolamine acid amidase
• Nacylethanolaminehydrolyzing Acid Amidase
• N-acylethanolamine-hydrolyzing acid amidase
• N-acylsphingosine amidohydrolase (acid ceramidase)-like
• N-acylsphingosine amidohydrolase-like
• PLT

Background

This gene encodes an N-acylethanolamine-hydrolyzing enzyme which is highly similar to acid ceramidase. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAAA
• Uniprot:
  • NP_055250(Human)