ASAH1 Antibody (1A7)

Images

 
Western Blot: ASAH1 Antibody (1A7) [H00000427-M02] - Analysis of ASAH1 expression in transfected 293T cell line by ASAH1 monoclonal antibody (M02), clone 1A7.Lane 1: ASAH1 transfected lysate(45 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: ASAH1 Antibody (1A7) [H00000427-M02] - Analysis of monoclonal antibody to ASAH1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
ELISA: ASAH1 Antibody (1A7) [H00000427-M02] - Detection limit for recombinant GST tagged ASAH1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
1A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ASAH1 Antibody (1A7) Summary

Immunogen
ASAH1 (NP_808592, 25 a.a. - 124 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLKVIVNSLKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD
Specificity
ASAH1 - N-acylsphingosine amidohydrolase (acid ceramidase) 1 (1A7)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ASAH1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ASAH1 Antibody (1A7)

  • ACDase
  • ACEC 3.5.1.23
  • Acid CDase
  • acid ceramidase
  • Acylsphingosine deacylase
  • ASAH
  • FLJ21558
  • FLJ22079
  • N-acylsphingosine amidohydrolase (acid ceramidase) 1
  • N-acylsphingosine amidohydrolase
  • PHP
  • PHP32N-acylsphingosine amidohydrolase (acid ceramidase)
  • Putative 32 kDa heart protein

Background

This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into sphingosine and fatty acid. Mutations in this gene have been associated with a lysosomal storage disorder known as Farber disease. Multiple transcript variants encoding several distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-35213
Species: Hu
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF7895
Species: Hu
Applications: WB, IHC
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
H00000427-M02
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for ASAH1 Antibody (H00000427-M02) (0)

There are no publications for ASAH1 Antibody (H00000427-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASAH1 Antibody (H00000427-M02) (0)

There are no reviews for ASAH1 Antibody (H00000427-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASAH1 Antibody (H00000427-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASAH1 Products

Bioinformatics Tool for ASAH1 Antibody (H00000427-M02)

Discover related pathways, diseases and genes to ASAH1 Antibody (H00000427-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASAH1 Antibody (H00000427-M02)

Discover more about diseases related to ASAH1 Antibody (H00000427-M02).
 

Pathways for ASAH1 Antibody (H00000427-M02)

View related products by pathway.

PTMs for ASAH1 Antibody (H00000427-M02)

Learn more about PTMs related to ASAH1 Antibody (H00000427-M02).

Blogs on ASAH1

There are no specific blogs for ASAH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASAH1 Antibody (1A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol ASAH1
Entrez
Uniprot