Recombinant Human ARVCF Protein

Images

 
SDS-Page: Recombinant Human ARVCF Protein [H00000421-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARVCF Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 863 - 962 of Human ARVCF partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGYSTVDRRERRPRGASSAGEASEKEPLKLDPSRKAPPPGPSRPAVRLVDAVGDAKPQPVDSWV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARVCF

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARVCF Protein

  • armadillo repeat gene deleted in velocardiofacial syndrome
  • armadillo repeat protein deleted in velo-cardio-facial syndrome
  • FLJ35345

Background

ARVCF - armadillo repeat gene deletes in velocardiofacial syndrome

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008502-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-59109
Species: Hu
Applications: WB, IHC, IHC-P
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00001501-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP1-92038
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-351
Species: Hu, Ha, Pm, Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARVCF Partial Recombinant Protein (H00000421-Q01) (0)

There are no publications for ARVCF Partial Recombinant Protein (H00000421-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARVCF Partial Recombinant Protein (H00000421-Q01) (0)

There are no reviews for ARVCF Partial Recombinant Protein (H00000421-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARVCF Partial Recombinant Protein (H00000421-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARVCF Products

Bioinformatics Tool for ARVCF Partial Recombinant Protein (H00000421-Q01)

Discover related pathways, diseases and genes to ARVCF Partial Recombinant Protein (H00000421-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARVCF Partial Recombinant Protein (H00000421-Q01)

Discover more about diseases related to ARVCF Partial Recombinant Protein (H00000421-Q01).
 

Pathways for ARVCF Partial Recombinant Protein (H00000421-Q01)

View related products by pathway.

PTMs for ARVCF Partial Recombinant Protein (H00000421-Q01)

Learn more about PTMs related to ARVCF Partial Recombinant Protein (H00000421-Q01).

Blogs on ARVCF

There are no specific blogs for ARVCF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
ARVCF Antibody
NBP2-38999

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARVCF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARVCF