Recombinant Human ARVCF GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human ARVCF Protein [H00000421-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ARVCF GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 863-962 of Human ARVCF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGYSTVDRRERRPRGASSAGEASEKEPLKLDPSRKAPPPGPSRPAVRLVDAVGDAKPQPVDSWV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARVCF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARVCF GST (N-Term) Protein

  • armadillo repeat gene deleted in velocardiofacial syndrome
  • armadillo repeat protein deleted in velo-cardio-facial syndrome
  • FLJ35345

Background

ARVCF - armadillo repeat gene deletes in velocardiofacial syndrome

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00008502-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-14119
Species: Hu
Applications: IHC, IHC-P
NB100-79781
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-89416
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92192
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-41387
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
H00001501-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
MAB9080
Species: Hu
Applications: WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86919
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86078
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP2-48622
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-351
Species: Ha, Hu, Mu(-), Pm, Rt(-)
Applications: ELISA, IHC, IHC-P, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for ARVCF Partial Recombinant Protein (H00000421-Q01) (0)

There are no publications for ARVCF Partial Recombinant Protein (H00000421-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARVCF Partial Recombinant Protein (H00000421-Q01) (0)

There are no reviews for ARVCF Partial Recombinant Protein (H00000421-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARVCF Partial Recombinant Protein (H00000421-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional ARVCF Products

Array H00000421-Q01

Bioinformatics Tool for ARVCF Partial Recombinant Protein (H00000421-Q01)

Discover related pathways, diseases and genes to ARVCF Partial Recombinant Protein (H00000421-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARVCF Partial Recombinant Protein (H00000421-Q01)

Discover more about diseases related to ARVCF Partial Recombinant Protein (H00000421-Q01).
 

Pathways for ARVCF Partial Recombinant Protein (H00000421-Q01)

View related products by pathway.

PTMs for ARVCF Partial Recombinant Protein (H00000421-Q01)

Learn more about PTMs related to ARVCF Partial Recombinant Protein (H00000421-Q01).

Blogs on ARVCF

There are no specific blogs for ARVCF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARVCF GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARVCF