ARSE Antibody

Images

 
Western Blot: ARSE Antibody [NBP1-62667] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARSE Antibody Summary

Immunogen
Synthetic peptides corresponding to ARSE(arylsulfatase E (chondrodysplasia punctata 1)) The peptide sequence was selected from the middle region of ARSE. Peptide sequence KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQAVWEHQRTLS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARSE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ARSE and was validated on Western blot.
Theoretical MW
62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARSE Antibody

  • arylsulfatase E (chondrodysplasia punctata 1)
  • arylsulfatase E
  • ASE
  • CDPX
  • CDPX1
  • CDPXR
  • chondrodysplasia punctata 1
  • EC 3.1.6
  • EC 3.1.6.-
  • EC 3.1.6.2
  • MGC163310

Background

Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-170 AC005295.1 87561-87730 c 171-744 AK223183.1 1-574 745-2036 AK223199.1 542-1833 2037-2220 AW779826.1 1-184 c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29942
Species: Hu, Rt
Applications: WB, Flow, IHC-P
NBP2-35216
Species: Hu
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-85495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67920
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55181
Species: Hu
Applications: ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00347527-P01
Species: Hu
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NBP1-76580
Species: Hu
Applications: WB, ELISA, ICC/IF, ICC
NBP1-76655
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ARSE Antibody (NBP1-62667) (0)

There are no publications for ARSE Antibody (NBP1-62667).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARSE Antibody (NBP1-62667) (0)

There are no reviews for ARSE Antibody (NBP1-62667). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARSE Antibody (NBP1-62667) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ARSE Antibody (NBP1-62667)

Discover related pathways, diseases and genes to ARSE Antibody (NBP1-62667). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARSE Antibody (NBP1-62667)

Discover more about diseases related to ARSE Antibody (NBP1-62667).
 

Pathways for ARSE Antibody (NBP1-62667)

View related products by pathway.

PTMs for ARSE Antibody (NBP1-62667)

Learn more about PTMs related to ARSE Antibody (NBP1-62667).
 

Research Areas for ARSE Antibody (NBP1-62667)

Find related products by research area.

Blogs on ARSE

There are no specific blogs for ARSE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARSE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARSE
Uniprot