ARP10 Antibody - BSA Free

Western Blot: ARP10 Antibody [NBP2-84468] - WB Suggested Anti-APOBEC3H Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ARP10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARP10 Antibody - BSA Free (NBP2-84468) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ARP10. Peptide sequence: SQVPVEVMGFPKFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APOBEC3H
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ARP10 Antibody - BSA Free

• APOBEC-related protein 10
• apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H
• ARP-10
• ARP10Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H
• DNA dC->dU-editing enzyme APOBEC-3H
• EC 3.5.4.-

Background

Members of the APOBEC family of proteins, like APOBEC3H, are mRNA editing enzymes that affect protein diversity by deamination of cytidine to produce uridine (Wedekind et al., 2003 [PubMed 12683974]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APOBEC3H