ARNTL2 Antibody

Images

 
Western Blot: ARNTL2 Antibody [NBP3-10507] - Western blot analysis using NBP3-10507 on Human MCF7 as a positive control. Antibody Titration: 0.2-1 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARNTL2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ARNTL2 (NP_064568). Peptide sequence PTAMGSFSSHMTEFPRKRKGSDSDPSQSGIMTEKVVEKLSQNPLTYLLST
Clonality
Polyclonal
Host
Rabbit
Gene
ARNTL2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
Theoretical MW
71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for ARNTL2 Antibody

  • Aryl hydrocarbon receptor nuclear translocator-like protein 2
  • Basic-helix-loop-helix-PAS protein MOP9
  • bHLHe6
  • BMAL2
  • Brain and muscle ARNT-like 2
  • Class E basic helix-loop-helix protein 6
  • CLIF
  • CYCLE-like factor
  • Member of PAS protein 9
  • MOP9
  • PAS domain-containing protein 9
  • PASD9
  • Transcription Factor BMAL2

Background

ARNTL2, or Aryl hydrocarbon receptor nuclear translocator-like protein 2, contains multiple isoforms that are 71 kDa, 69 kDa, 67 kDa, 66 kDa, 65.5 kDa, 65 kDa, 64 kDa, 61 kDa, and 60 kDa, and is involved in the activation of E-box element transcription. The protein has been linked to a variety of diseases and disorders through current research, including hypoxia, alcoholism, bipolar disorder, neuronitis, lupus erythematosus, schizophrenia, schizoaffective disorder, anemia, mood disorder, and Fanconi's anemia. ARNTL2 is associated with circadian rhythm and the regulation of transcription, and interacts with CLOCK, EPAS1, UBC, SERPINE1, and NPAS2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2288
Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
NB100-126
Species: Hu, Mu
Applications: ChIP, WB
NBP2-24589
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, WB
NB100-125
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
DSE100
Species: Hu
Applications: ELISA
NBP3-12196
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP1-88612
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-00749
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3764
Species: Hu, Mu
Applications: ICC, IHC, WB
NB100-1800
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-124
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: CHIP-SEQ, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
NBP1-19613
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86436
Species: Hu
Applications: IHC, IHC-P
NBP1-83837
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
NBP2-83997
Species: Hu
Applications: IHC, IHC-P, WB
664-LI/CF
Species: Hu
Applications: BA
NBP3-10507
Species: Hu
Applications: WB, IHC

Publications for ARNTL2 Antibody (NBP3-10507) (0)

There are no publications for ARNTL2 Antibody (NBP3-10507).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARNTL2 Antibody (NBP3-10507) (0)

There are no reviews for ARNTL2 Antibody (NBP3-10507). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARNTL2 Antibody (NBP3-10507) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARNTL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARNTL2