ARMER Antibody - BSA Free

Western Blot: ARMER Antibody [NBP3-35720] - Western blot analysis of various lysates, using ARMER Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Immunohistochemistry: ARMER Antibody [NBP3-35720] - Immunohistochemistry analysis of ARMER in paraffin-embedded Rat testis tissue using ARMER Rabbit pAb at a dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer(pH 7.2) prior to IHC staining.

Immunohistochemistry: ARMER Antibody [NBP3-35720] - Immunohistochemistry analysis of ARMER in paraffin-embedded Mouse testis tissue using ARMER Rabbit pAb at a dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer(pH 7.2) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARMER Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARMER Antibody - BSA Free (NBP3-35720) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARMER (NP_055976.1).
  
  Sequence:
  MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARL6IP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:100
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ARMER Antibody - BSA Free

• ADP-ribosylation factor-like 6 interacting protein 1
• ADP-ribosylation factor-like 6 interacting protein
• AIP1
• Aip-1
• apoptotic regulator in the membrane of the endoplasmic reticulum
• ARL-6-interacting protein 1
• ARL6IPaip-1
• ARMER
• KIAA0069ADP-ribosylation factor-like protein 6-interacting protein 1

Background

Apoptosis is important for normal development and tissue homeostasis. It is mediated by various caspases and ultimately results in the activation of endogenous endonucleases that degrade cellular DNA. Although apoptosis induced by endoplasmic reticulum (ER) stress is thought to be mediated by caspase-12, other caspases such as caspase-9 are also thought to be activated following ER stress. Recently, ARMER, a novel integral ER-membrane protein was shown to protect cells from ER stress-induced apoptosis. Analysis of the caspase proteolytic cascade suggests that ARMER acts by inhibiting caspase-9 activity (3), although the mechanism for this remains unkown. It should be noted that ARMER is not related to the inhibitor of apoptosis proteins (IAP) family and does not contain any baculoviral IAP repeat (BIR) domains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARL6IP1