Home » ARMER » ARMER Antibodies » ARMER Antibody

ARMER Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human pancreas shows moderate to strong membranous positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human pancreas shows moderate to strong membranous positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ARMER Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE
Predicted Species
Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARL6IP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARMER Protein (NBP1-91681PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARMER Antibody

  • ADP-ribosylation factor-like 6 interacting protein 1
  • ADP-ribosylation factor-like 6 interacting protein
  • AIP1
  • Aip-1
  • apoptotic regulator in the membrane of the endoplasmic reticulum
  • ARL-6-interacting protein 1
  • ARL6IPaip-1
  • ARMER
  • KIAA0069ADP-ribosylation factor-like protein 6-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Alix Antibody
NBP1-90201
Western Blot: Alix Antibody [NBP1-90201] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDCD6IP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Alix Antibody [NBP1-90201] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Alix Antibody [NBP1-90201] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
(1 Review)
(6 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
PDCD6 Antibody
NBP2-94061
Immunocytochemistry/Immunofluorescence: PDCD6 Antibody [NBP2-94061] - Analysis of HeLa cells using PDCD6 . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: PDCD6 Antibody [NBP2-94061] - Paraffin-embedded rat kidney using PDCD6 .
Western Blot: PDCD6 Antibody [NBP2-94061] - Analysis of extracts of various cell lines, using PDCD6 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Destrin Antibody
(OTI2F7)
NBP2-00527
Flow Cytometry: Destrin Antibody (2F7) [NBP2-00527] - Analysis of Hela cells, using anti-Destrin antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Destrin Antibody (2F7) [NBP2-00527] - Analysis of Jurkat cells, using anti-Destrin antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Destrin Antibody (2F7) [NBP2-00527] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Destrin antibody, and then analyzed by flow cytometry.
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(676 Publications)
Species: Hu
Applications: BA
WDR1 Antibody
NBP2-32665
Western Blot: WDR1 Antibody [NBP2-32665] - Analysis in human cell line MOLT-4.
Immunohistochemistry-Paraffin: WDR1 Antibody [NBP2-32665] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: WDR1 Antibody [NBP2-32665] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle and glandular cells.
Species: Hu
Applications: IHC, IHC-P, WB
Gelsolin/GSN
Antibody
NBP1-33177
Immunocytochemistry/Immunofluorescence: Gelsolin/GSN Antibody [NBP1-33177] - Methanol-fixed HeLa, using Gelsolin antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with Red at 1:2000.
Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP1-33177] - H1299 xenograft, using Gelsolin antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
Western Blot: Gelsolin/GSN Antibody [NBP1-33177] - Sample (30 ug of whole cell lysate) A: H1299 B: Hela 7.5% SDS PAGE; antibody diluted at 1:1000.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Thioredoxin-1
Antibody
NBP2-52983
Flow Cytometry: Thioredoxin-1 Antibody [NBP2-52983] - Thioredoxin Antibody [NBP2-52983] - An intracellular stain was performed on U-87 MG cells with Thioredoxin Antibody NBP2-52983 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Immunocytochemistry/Immunofluorescence: Thioredoxin Antibody [NBP2-52983] - NIH-3T3 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Thioredoxin at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: Thioredoxin Antibody [NBP2-52983] - PC12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Thioredoxin at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(1 Publication)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TSG101 Antibody
(4A10)
NB200-112
Western Blot: TSG101 Antibody (4A10) [NB200-112] - Lane 1: MWM, Lane 2: TSG101 in RAW 264.7 Whole Cell Lysate, Lane 3: Exosome Lysate. Used primary antibody at 1:500 and Donkey Anti-Mouse at 0.5 ug/mL (this could be titrated down to reduce background). Used picogram sensitivity ECL reagents. Image from verified customer review.
Flow Cytometry: TSG101 Antibody (4A10) [NB200-112] - An intracellular stain was performed on HeLa cells with TSG101 Antibody (4A10) NB200-112F (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to FITC.
Flow Cytometry: TSG101 Antibody (4A10) [NB200-112] - An intracellular stain was performed on Hek293 cells with TSG101 Antibody [4A10] NB200-112PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(2 Reviews)
(82 Publications)
Species: Ha, Hu, Pm, Mu, Pm, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, WB
MAGI2 Antibody
AF7117
Western blot shows lysates of human brain (cortex) tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human MAGI2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7117) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for MAGI2 at approximately 170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
MAGI2 was detected in immersion fixed paraffin-embedded sections of human brain (hippocampus) using Goat Anti-Human MAGI2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7117) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to synaptic boutons and neuronal processes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
MAGI2 was detected in immersion fixed U‑87 MG human glioblastoma/astrocytoma cell line using Goat Anti-Human MAGI2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7117) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu, Mu
Applications: ICC, IHC, WB
p53 Antibody (PAb
240)
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Recombinant Human
VPS4A GST (N-Term) Pr ...
H00027183-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
ASK1 Antibody
NB100-81788
Western Blot: ASK1 Antibody [NB100-81788] - Analysis of extracts from 293 and Hela cells using ASK1(Ab-966) antibody
Immunocytochemistry/Immunofluorescence: ASK1 Antibody [NB100-81788] - Staining of methanol-fixed Hela cells using ASK1(Ab-966) antibody
Immunohistochemistry-Paraffin: ASK1 Antibody [NB100-81788] - Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue, using ASK1 (Ab-966) antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CIN85/SH3KBP1
Antibody
NBP1-85614
Western Blot: CIN85/SH3KBP1 Antibody [NBP1-85614] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: CIN85/SH3KBP1 Antibody [NBP1-85614] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: CIN85/SH3KBP1 Antibody [NBP1-85614] - Staining in human lymph node and skeletal muscle tissues using anti-SH3KBP1 antibody. Corresponding SH3KBP1 RNA-seq data are presented for the same tissues.
Species: Hu, Mu
Applications: IHC, IHC-P, WB
DAB2IP Antibody
NBP1-30081
Western Blot: DAB2IP Antibody [NBP1-30081] - Whole cell lysate from HeLa cells. DAB2IP was also IPed by rabbit anti-DAB2IP antibody NBP1-30082. For blotting immunoprecipitated DAB2IP, the ReliaBLOT (Trademark) Reagents and Procedures were used.
Western Blot: DAB2IP Antibody [NBP1-30081] - Detection of Mouse DAB2IP by Western Blot. Samples: Whole cell lysate (50 ug) from TCMK-1, Renca, 4T1, and CT26.WT cells. Antibodies: Affinity purified rabbit anti-DAB2IP antibody NBP1-30081 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
(1 Publication)
Species: Hu, Mu
Applications: IP, WB
JNK1 [p Thr183, p
Thr221] Antibody (ST5 ...
NBP2-67514
Flow Cytometry: JNK1 [p Thr183, p Thr221] Antibody (ST500) [NBP2-67514] - Analysis of Hela cells with Phospho-JNK1/2/3(T183+T183+T221) antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the second
Immunocytochemistry/Immunofluorescence: JNK1 [p Thr183, p Thr221] Antibody (ST500) [NBP2-67514] - Staining Phospho-JNK1/2/3(T183+T183+T221) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: JNK1 [p Thr183, p Thr221] Antibody (ST500) [NBP2-67514] - Staining Phospho-JNK1/2/3(T183+T183+T221) in HUVEC cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
CHMP4A Antibody
NBP3-06005
Western Blot: CHMP4A Antibody [NBP3-06005] - Anti-CHMP4A rabbit polyclonal antibody at 1:500 dilution Lane A: HepG2 Whole Cell Lysate Lane B: RT4 Whole Cell Lysate Lane C: HL60 Whole Cell Lysate Lane D: MOLT4 Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)HRP at 110000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size:25 kDa Observed band size:32 kDa
CHMP4A Antibody [NBP3-06005] - CHMP4A was immunoprecipitated using: Lane A:0.5 mg HepG2 Whole Cell Lysate 4 uL anti-CHMP4A rabbit polyclonal antibody and 60 ug of Immunomagnetic beads Protein AG. Primary antibody: Anti-CHMP4A rabbit polyclonal antibody,at 1:100 dilution Secondary antibody: Goat Anti-Rabbit IgG (H+L)HRP at 110000 dilution Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 25 kDa Observed band size :32 kDa
Species: Hu
Applications: IHC, IHC-P, IP, WB
AIP/ARA9 Antibody
(35-2)
NB100-127
Immunohistochemistry-Paraffin: AIP/ARA9 Antibody (35-2) [NB100-127] - AIP/ARA9 was detected in immersion fixed paraffin-embedded sections of human spleen using Mouse Anti-Human AIP/ARA9 (35-2) Monoclonal Antibody (Catalog # NB100-127) at 1:300 for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm in splenocytes.
Immunohistochemistry: AIP/ARA9 Antibody (35-2) [NB100-127] - Fig 1. Aryl hydrocarbon receptor interacting protein (AIP) immunostaining.A and B Examples of low AIP expression; C and D: Examples of high AIP expression; E Normal human pituitary staining with omitting primary antibody (negative control); F Normal human pituitary staining with AIP (positive control); Scale bar = 1000 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0117107) licensed under a CC-BY licence.
Flow Cytometry: AIP/ARA9 Antibody (35-2) [NB100-127] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and MCF-7 (B) cells using AIP/ARA9 antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(4 Reviews)
(30 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
ERK2 Antibody
(OTI6E5)
NBP1-47842
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Immunoprecipitation: ERK2 Antibody (6E5) [NBP1-47842] - TrueMab monoclonal anti-ERK2 antibody (Negative control: IP without adding anti-ERK2 antibody). For each experiment, 500ul of DDK tagged ERK2 overexpression lysates (at 1:5 dilution with HEK293T lysate), 2ug of antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-ERK2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AKIP Antibody
NBP1-90202
Immunocytochemistry/Immunofluorescence: AKIP Antibody [NBP1-90202] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, mitochondria & vesicles.
Immunohistochemistry-Paraffin: AKIP Antibody [NBP1-90202] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CBL Antibody (3B12)
NBP2-37574
ELISA: CBL Antibody (3B12) [NBP2-37574] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: CBL Antibody (3B12) [NBP2-37574] - Western blot analysis using C-CBL mAb against human C-CBL (AA: 684-865) recombinant protein. (Expected MW is 44.9 kDa)
Western Blot: CBL Antibody (3B12) [NBP2-37574] - Western blot analysis using C-CBL mouse mAb against RAJI (1), RAW264.7 (2), K562 (3), SKBR-3 (4), 3T3-L1 (5), THP-1 (6) and PC-12 (7) cell lysate.
(1 Review)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for ARMER Antibody (NBP1-91681) (0)

There are no publications for ARMER Antibody (NBP1-91681).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARMER Antibody (NBP1-91681) (0)

There are no reviews for ARMER Antibody (NBP1-91681). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARMER Antibody (NBP1-91681) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ARMER Products

Bioinformatics Tool for ARMER Antibody (NBP1-91681)

Discover related pathways, diseases and genes to ARMER Antibody (NBP1-91681). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARMER Antibody (NBP1-91681)

Discover more about diseases related to ARMER Antibody (NBP1-91681).
 

Pathways for ARMER Antibody (NBP1-91681)

View related products by pathway.

PTMs for ARMER Antibody (NBP1-91681)

Learn more about PTMs related to ARMER Antibody (NBP1-91681).
 

Research Areas for ARMER Antibody (NBP1-91681)

Find related products by research area.

Blogs on ARMER

There are no specific blogs for ARMER, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARMER Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ARL6IP1
Entrez
Uniprot