ARMER Antibody - BSA Free

Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human pancreas shows moderate to strong membranous positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.

Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.

Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.

Staining of human pancreas shows moderate to strong membranous positivity in exocrine glandular cells.

Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARMER Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE
• Predicted Species: Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARL6IP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ARMER Protein (NBP1-91681PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARMER Antibody - BSA Free

• ADP-ribosylation factor-like 6 interacting protein 1
• ADP-ribosylation factor-like 6 interacting protein
• AIP1
• Aip-1
• apoptotic regulator in the membrane of the endoplasmic reticulum
• ARL-6-interacting protein 1
• ARL6IPaip-1
• ARMER
• KIAA0069ADP-ribosylation factor-like protein 6-interacting protein 1

Background

Apoptosis is important for normal development and tissue homeostasis. It is mediated by various caspases and ultimately results in the activation of endogenous endonucleases that degrade cellular DNA. Although apoptosis induced by endoplasmic reticulum (ER) stress is thought to be mediated by caspase-12, other caspases such as caspase-9 are also thought to be activated following ER stress. Recently, ARMER, a novel integral ER-membrane protein was shown to protect cells from ER stress-induced apoptosis. Analysis of the caspase proteolytic cascade suggests that ARMER acts by inhibiting caspase-9 activity (3), although the mechanism for this remains unkown. It should be noted that ARMER is not related to the inhibitor of apoptosis proteins (IAP) family and does not contain any baculoviral IAP repeat (BIR) domains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARL6IP1
• Entrez:
  • 23204(Human)
• Uniprot:
  • Q15041(Human)