ARMER Antibody

Images

 
Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human pancreas shows moderate to strong membranous positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARMER Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE
Predicted Species
Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARL6IP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARMER Protein (NBP1-91681PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARMER Antibody

  • ADP-ribosylation factor-like 6 interacting protein 1
  • ADP-ribosylation factor-like 6 interacting protein
  • AIP1
  • Aip-1
  • apoptotic regulator in the membrane of the endoplasmic reticulum
  • ARL-6-interacting protein 1
  • ARL6IPaip-1
  • ARMER
  • KIAA0069ADP-ribosylation factor-like protein 6-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90201
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-94061
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-00527
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-32665
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-33177
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-112
Species: Ha, Hu, Pm, Mu, Pm, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, WB
AF7117
Species: Hu, Mu
Applications: ICC, IHC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00027183-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-81788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85614
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-30081
Species: Hu, Mu
Applications: IP, WB
NBP2-67514
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP3-06005
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB100-127
Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-90202
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for ARMER Antibody (NBP1-91681) (0)

There are no publications for ARMER Antibody (NBP1-91681).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARMER Antibody (NBP1-91681) (0)

There are no reviews for ARMER Antibody (NBP1-91681). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARMER Antibody (NBP1-91681) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARMER Products

Bioinformatics Tool for ARMER Antibody (NBP1-91681)

Discover related pathways, diseases and genes to ARMER Antibody (NBP1-91681). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARMER Antibody (NBP1-91681)

Discover more about diseases related to ARMER Antibody (NBP1-91681).
 

Pathways for ARMER Antibody (NBP1-91681)

View related products by pathway.

PTMs for ARMER Antibody (NBP1-91681)

Learn more about PTMs related to ARMER Antibody (NBP1-91681).
 

Research Areas for ARMER Antibody (NBP1-91681)

Find related products by research area.

Blogs on ARMER

There are no specific blogs for ARMER, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARMER Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL6IP1
Entrez
Uniprot