ARMER Antibody - BSA Free

Images

 
Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human pancreas shows moderate to strong membranous positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ARMER Antibody [NBP1-91681] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
Staining of human pancreas shows moderate to strong membranous positivity in exocrine glandular cells.
Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

ARMER Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit ARMER Antibody - BSA Free (NBP1-91681) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE
Predicted Species
Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARL6IP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARMER Protein (NBP1-91681PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARMER Antibody - BSA Free

  • ADP-ribosylation factor-like 6 interacting protein 1
  • ADP-ribosylation factor-like 6 interacting protein
  • AIP1
  • Aip-1
  • apoptotic regulator in the membrane of the endoplasmic reticulum
  • ARL-6-interacting protein 1
  • ARL6IPaip-1
  • ARMER
  • KIAA0069ADP-ribosylation factor-like protein 6-interacting protein 1

Background

Apoptosis is important for normal development and tissue homeostasis. It is mediated by various caspases and ultimately results in the activation of endogenous endonucleases that degrade cellular DNA. Although apoptosis induced by endoplasmic reticulum (ER) stress is thought to be mediated by caspase-12, other caspases such as caspase-9 are also thought to be activated following ER stress. Recently, ARMER, a novel integral ER-membrane protein was shown to protect cells from ER stress-induced apoptosis. Analysis of the caspase proteolytic cascade suggests that ARMER acts by inhibiting caspase-9 activity (3), although the mechanism for this remains unkown. It should be noted that ARMER is not related to the inhibitor of apoptosis proteins (IAP) family and does not contain any baculoviral IAP repeat (BIR) domains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90201
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
MAB6015
Species: Hu, Mu, Rt
Applications: WB
NBP2-00527
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF-410-NA
Species: Hu, Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, ICFlow, Neut, WB
NBP2-32665
Species: Hu
Applications: IHC,  IHC-P, WB
MAB8170
Species: Hu, Mu, Rt
Applications: IHC, KO, mIF, Simple Western, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-77452
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF7117
Species: Hu, Mu
Applications: ICC, IHC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-27784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-56077
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-85615
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-32254
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49557
Species: Hu
Applications: IHC,  IHC-P
NBP1-31347
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-90202
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-86588
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for ARMER Antibody (NBP1-91681) (0)

There are no publications for ARMER Antibody (NBP1-91681).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARMER Antibody (NBP1-91681) (0)

There are no reviews for ARMER Antibody (NBP1-91681). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARMER Antibody (NBP1-91681) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARMER Products

Research Areas for ARMER Antibody (NBP1-91681)

Find related products by research area.

Blogs on ARMER

There are no specific blogs for ARMER, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARMER Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL6IP1
Entrez
Uniprot