ARL6IP4 Antibody - Azide and BSA Free

Immunohistochemistry-Paraffin: ARL6IP4 Antibody [NBP3-04956] - Paraffin-embedded human lung using ARL6IP4 antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: ARL6IP4 Antibody [NBP3-04956] - Paraffin-embedded human breast cancer using ARL6IP4 antibody at dilution of 1:100 (40x lens).

• Reactivity: Hu
• Applications: ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ARL6IP4 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit ARL6IP4 Antibody - Azide and BSA Free (NBP3-04956) is a polyclonal antibody validated for use in IHC and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 313-402 of human ARL6IP4 (NP_057722.3). SAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARL6IP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ARL6IP4 Antibody - Azide and BSA Free

• ADP-ribosylation-like factor 6 interacting protein 4
• Aip-4
• ARL-6-interacting protein 4
• HSP-975
• HSVI binding protein
• HSVI-binding protein
• MGC814
• SFRS20
• splicing factor, arginine/serine-rich 20
• splicing regulator SRrp38
• SR-15
• SR-25ADP-ribosylation factor-like protein 6-interacting protein 4
• SRp25 nuclear protein
• SRp25aip-4
• SRrp37

Background

ARL6IP4 interacts with ADP-ribosylation-like factor 6. ADP-ribosylation factors function as regulators of vesicular traffic and actin remodelling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ARL6IP4