ARL6IP4 Antibody

Images

 
Western Blot: ARL6IP4 Antibody [NBP2-14313] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: ARL6IP4 Antibody [NBP2-14313] - Staining of human colon shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARL6IP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KKGKEKAEAQQVEALPGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPM TKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKVGV A
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARL6IP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500-1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARL6IP4 Protein (NBP2-14313PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARL6IP4 Antibody

  • ADP-ribosylation-like factor 6 interacting protein 4
  • Aip-4
  • ARL-6-interacting protein 4
  • HSP-975
  • HSVI binding protein
  • HSVI-binding protein
  • MGC814
  • SFRS20
  • splicing factor, arginine/serine-rich 20
  • splicing regulator SRrp38
  • SR-15
  • SR-25ADP-ribosylation factor-like protein 6-interacting protein 4
  • SRp25 nuclear protein
  • SRp25aip-4
  • SRrp37

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP1-90202
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-127
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-86769
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-85993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-57131
Species: Hu
Applications: WB
NBP2-49637
Species: Hu
Applications: WB, IHC
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-84161
Species: Hu
Applications: IHC, IHC-P
NBP2-24737
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for ARL6IP4 Antibody (NBP2-14313) (0)

There are no publications for ARL6IP4 Antibody (NBP2-14313).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL6IP4 Antibody (NBP2-14313) (0)

There are no reviews for ARL6IP4 Antibody (NBP2-14313). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARL6IP4 Antibody (NBP2-14313) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARL6IP4 Products

Bioinformatics Tool for ARL6IP4 Antibody (NBP2-14313)

Discover related pathways, diseases and genes to ARL6IP4 Antibody (NBP2-14313). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL6IP4 Antibody (NBP2-14313)

Discover more about diseases related to ARL6IP4 Antibody (NBP2-14313).
 

Pathways for ARL6IP4 Antibody (NBP2-14313)

View related products by pathway.

PTMs for ARL6IP4 Antibody (NBP2-14313)

Learn more about PTMs related to ARL6IP4 Antibody (NBP2-14313).

Blogs on ARL6IP4

There are no specific blogs for ARL6IP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARL6IP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL6IP4
Entrez
Uniprot