ARL3 Antibody

Images

 
Western Blot: ARL3 Antibody [NBP1-88839] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ARL3 Antibody [NBP1-88839] - Staining of human cerebral cortex shows strong cytoplasmic and nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ARL3 Protein (NBP1-88839PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARL3 Antibody

  • ADP-ribosylation factor-like 3
  • ARFL3ADP-ribosylation factor-like protein 3
  • ARF-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006102-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009094-M01
Species: Hu
Applications: WB, ELISA, IP
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13407
Species: Hu
Applications: IHC, IHC-P
NBP2-49680
Species: Hu
Applications: WB, IHC
NBP1-72058
Species: Hu
Applications: WB, PEP-ELISA
NBP2-34951
Species: Hu
NBP2-31820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for ARL3 Antibody (NBP1-88839) (0)

There are no publications for ARL3 Antibody (NBP1-88839).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL3 Antibody (NBP1-88839) (0)

There are no reviews for ARL3 Antibody (NBP1-88839). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARL3 Antibody (NBP1-88839) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARL3 Products

Bioinformatics Tool for ARL3 Antibody (NBP1-88839)

Discover related pathways, diseases and genes to ARL3 Antibody (NBP1-88839). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL3 Antibody (NBP1-88839)

Discover more about diseases related to ARL3 Antibody (NBP1-88839).
 

Pathways for ARL3 Antibody (NBP1-88839)

View related products by pathway.

PTMs for ARL3 Antibody (NBP1-88839)

Learn more about PTMs related to ARL3 Antibody (NBP1-88839).
 

Research Areas for ARL3 Antibody (NBP1-88839)

Find related products by research area.

Blogs on ARL3

There are no specific blogs for ARL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL3
Entrez
Uniprot