ARL2BP Antibody


Immunohistochemistry: ARL2BP Antibody [NBP2-30681] - Staining of human stomach, lower shows distinct granular cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

ARL2BP Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: IPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNN
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARL2BP Protein (NBP2-30681PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ARL2BP Antibody

  • ADP-ribosylation factor-like 2 binding protein
  • ADP-ribosylation factor-like protein 2-binding protein
  • ARF-like 2-binding protein
  • BART1binder of Arl Two
  • BARTArf-like 2 binding protein BART1
  • Binder of ARF2 protein 1
  • binder of Arl2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi SP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: WB, ChIP, ELISA

Publications for ARL2BP Antibody (NBP2-30681) (0)

There are no publications for ARL2BP Antibody (NBP2-30681).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL2BP Antibody (NBP2-30681) (0)

There are no reviews for ARL2BP Antibody (NBP2-30681). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARL2BP Antibody (NBP2-30681) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ARL2BP Products

Bioinformatics Tool for ARL2BP Antibody (NBP2-30681)

Discover related pathways, diseases and genes to ARL2BP Antibody (NBP2-30681). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL2BP Antibody (NBP2-30681)

Discover more about diseases related to ARL2BP Antibody (NBP2-30681).

Pathways for ARL2BP Antibody (NBP2-30681)

View related products by pathway.

PTMs for ARL2BP Antibody (NBP2-30681)

Learn more about PTMs related to ARL2BP Antibody (NBP2-30681).

Research Areas for ARL2BP Antibody (NBP2-30681)

Find related products by research area.

Blogs on ARL2BP

There are no specific blogs for ARL2BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARL2BP Antibody and receive a gift card or discount.


Gene Symbol ARL2BP