ARL11 Antibody

Images

 
Western Blot: ARL11 Antibody [NBP1-88989] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: ARL11 Antibody [NBP1-88989] - Staining of human testis shows moderate cytoplasmic positivity in seminiferus ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARL11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARL11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARL11 Protein (NBP1-88989PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARL11 Antibody

  • ADP-ribosylation factor-like 11
  • ADP-ribosylation factor-like protein 11
  • ADP-ribosylation factor-like tumor suppressor protein 1
  • ARLTS1FLJ33930
  • MGC17429

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49532
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-2590
Species: Hu
Applications: IP (-), WB, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-25959
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
MAB2476
Species: Hu
Applications: WB, IHC
AF4885
Species: Mu
Applications: WB, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88989
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARL11 Antibody (NBP1-88989) (0)

There are no publications for ARL11 Antibody (NBP1-88989).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL11 Antibody (NBP1-88989) (0)

There are no reviews for ARL11 Antibody (NBP1-88989). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARL11 Antibody (NBP1-88989) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARL11 Products

Bioinformatics Tool for ARL11 Antibody (NBP1-88989)

Discover related pathways, diseases and genes to ARL11 Antibody (NBP1-88989). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL11 Antibody (NBP1-88989)

Discover more about diseases related to ARL11 Antibody (NBP1-88989).
 

Pathways for ARL11 Antibody (NBP1-88989)

View related products by pathway.

PTMs for ARL11 Antibody (NBP1-88989)

Learn more about PTMs related to ARL11 Antibody (NBP1-88989).
 

Research Areas for ARL11 Antibody (NBP1-88989)

Find related products by research area.

Blogs on ARL11

There are no specific blogs for ARL11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARL11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL11
Entrez
Uniprot