ARID5A Antibody

Images

 
Western Blot: ARID5A Antibody [H00010865-B01P] - Analysis of ARID5A expression in transfected 293T cell line by ARID5A polyclonal antibody. Lane 1: ARID5A transfected lysate(47.3 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ARID5A Antibody Summary

Immunogen
ARID5A (AAH67301.1, 1 a.a. - 430 a.a.) full-length human protein. MAKENRGDDGATERPKKAKEERRMDQMMPGKTKADAADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASGCPEAYKRLLSSFYCKGTHGIMSPLAKKKLLAQVSKVEALQCQEEGCRHGAEPQASPAVHLPESPQSPKGLTENSRHRLTPQEGLQAPGGSLREEAQAGPCPAAPIFKGCFYTHPTEVLKPVSQHPRDFFSRLKDGVLLGPPGKEGLSVKEPQLVWGGDANRPSAFHKGGSRKGILYPKPKACWVSPMAKVPAESPTLPPTFPSSPGLGSKRSLEEEGAAHSGKRLRAVSPFLKEADAKKCGAKPAGSGLVSCLLGPALGPVPPEAYRGTMLHCPLNFTGTPGPLKGQAALPFSPLVIPAFPAHFLATAGPSPMAAGLMHFPPTSFDSALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL
Specificity
ARID5A - AT rich interactive domain 5A (MRF1-like),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ARID5A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARID5A Antibody

  • ARID domain-containing protein 5A
  • AT rich interactive domain 5A (MRF1-like)
  • AT-rich interactive domain-containing protein 5A
  • RFVG5814

Background

Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development, tissue-specific gene expression, and regulation of cell growth (Patsialou et al., 2005 [PubMed 15640446]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1028
Species: Hu, Mu, Rt, Ca, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-81021
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NBP1-86380
Species: Hu, Mu, Bv
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
MAB8175
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-31113
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-59777
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00009617-B01P
Species: Hu
Applications: WB
AF3075
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-32530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1774
Species: Hu, Mu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IHC-Fr, IHC-P, IP, IHC-FrFl, KO
NBP1-30052
Species: Hu, Mu, Rt, Ch, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
H00010865-B01P
Species: Hu
Applications: WB

Publications for ARID5A Antibody (H00010865-B01P) (0)

There are no publications for ARID5A Antibody (H00010865-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARID5A Antibody (H00010865-B01P) (0)

There are no reviews for ARID5A Antibody (H00010865-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARID5A Antibody (H00010865-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARID5A Products

Bioinformatics Tool for ARID5A Antibody (H00010865-B01P)

Discover related pathways, diseases and genes to ARID5A Antibody (H00010865-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARID5A Antibody (H00010865-B01P)

Discover more about diseases related to ARID5A Antibody (H00010865-B01P).
 

Pathways for ARID5A Antibody (H00010865-B01P)

View related products by pathway.

PTMs for ARID5A Antibody (H00010865-B01P)

Learn more about PTMs related to ARID5A Antibody (H00010865-B01P).

Blogs on ARID5A

There are no specific blogs for ARID5A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARID5A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARID5A
Entrez