ARHGAP1 Antibody

Images

 
Western Blot: ARHGAP1 Antibody [NBP1-85725] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ARHGAP1 Antibody [NBP1-85725] - Staining of human small intestine shows strong immunoreactivity along the luminal membrane and moderate cytoplasmic positivity in glandular cells.
Western Blot: ARHGAP1 Antibody [NBP1-85725] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARHGAP1 Protein (NBP1-85725PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGAP1 Antibody

  • ARHGAP1
  • CDC42 GTPase-activating protein
  • CDC42GAP
  • CDC42GAPp50-RhoGAP
  • GTPase-activating protein rhoOGAP
  • p50rhoGAP
  • Rho GTPase activating protein 1
  • rho GTPase-activating protein 1
  • RhoGAP
  • RHOGAP1Cdc42GAP
  • Rho-related small GTPase protein activator
  • Rho-type GTPase-activating protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88559
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-88154
Species: Hu, Mu
Applications: WB, IP, PLA
AF877
Species: Hu
Applications: WB, IHC, IP
NBP2-20158
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF7548
Species: Hu
Applications: IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-57680
Species: Hu
Applications: ICC/IF
NBP1-85725
Species: Hu, Mu, Rt, Mu
Applications: WB, IHC, IHC-P

Publications for ARHGAP1 Antibody (NBP1-85725) (0)

There are no publications for ARHGAP1 Antibody (NBP1-85725).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP1 Antibody (NBP1-85725) (0)

There are no reviews for ARHGAP1 Antibody (NBP1-85725). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGAP1 Antibody (NBP1-85725) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP1
Entrez