Reactivity | Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb, ZeSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to EIF2C3(eukaryotic translation initiation factor 2C, 3) The peptide sequence was selected from the N terminal of EIF2C3. Peptide sequence MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species | Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Rabbit (100%), Zebrafish (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | AGO3 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | This is a rabbit polyclonal antibody against EIF2C3 and was validated on Western blot. |
||
Theoretical MW | 69 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
Control |
|
||
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-54932 | Applications | Species |
---|---|---|
Sasaki,T. Genomics 82 (3), 323-330. 2003 [PMID: 12906857] |
Secondary Antibodies |
Isotype Controls |
Diseases for Argonaute 3 Antibody (NBP1-54932)Discover more about diseases related to Argonaute 3 Antibody (NBP1-54932).
| Pathways for Argonaute 3 Antibody (NBP1-54932)View related products by pathway.
|
PTMs for Argonaute 3 Antibody (NBP1-54932)Learn more about PTMs related to Argonaute 3 Antibody (NBP1-54932).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.