Argonaute 3 Antibody

Images

 
Western Blot: Argonaute 3 Antibody [NBP1-54932] - Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Argonaute 3 Antibody Summary

Immunogen
Synthetic peptides corresponding to EIF2C3(eukaryotic translation initiation factor 2C, 3) The peptide sequence was selected from the N terminal of EIF2C3. Peptide sequence MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Rabbit (100%), Zebrafish (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGO3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against EIF2C3 and was validated on Western blot.
Theoretical MW
69 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
Argonaute 3 Knockout HeLa Cell Lysate
Publications
Read Publication using NBP1-54932.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Argonaute 3 Antibody

  • AGO3argonaute 3
  • argonaute3
  • eIF2C 3
  • eIF-2C 3
  • Eukaryotic translation initiation factor 2C 3
  • eukaryotic translation initiation factor 2C, 3
  • FLJ12765
  • hAgo3
  • MGC86946
  • protein argonaute-3

Background

EIF2C3 is a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing. This gene is

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06062
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-37398
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-59631
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71691
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56648
Species: Hu, Mu, Rt
Applications: WB
NBP2-24590
Species: Mu
Applications: WB, IHC, IHC-P
AF2030
Species: Hu
Applications: WB, IHC
NBP1-03349
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-57549
Species: Hu
Applications: WB
NBP2-31855
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-28751
Species: Hu, Mu
Applications: WB, IB, IP, KD
NBP1-77139
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB200-191
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-54932
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb, Ze
Applications: WB

Publications for Argonaute 3 Antibody (NBP1-54932)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-54932 Applications Species
Sasaki,T. Genomics 82 (3), 323-330. 2003 [PMID: 12906857]

Reviews for Argonaute 3 Antibody (NBP1-54932) (0)

There are no reviews for Argonaute 3 Antibody (NBP1-54932). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Argonaute 3 Antibody (NBP1-54932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Argonaute 3 Products

Bioinformatics Tool for Argonaute 3 Antibody (NBP1-54932)

Discover related pathways, diseases and genes to Argonaute 3 Antibody (NBP1-54932). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Argonaute 3 Antibody (NBP1-54932)

Discover more about diseases related to Argonaute 3 Antibody (NBP1-54932).
 

Pathways for Argonaute 3 Antibody (NBP1-54932)

View related products by pathway.

PTMs for Argonaute 3 Antibody (NBP1-54932)

Learn more about PTMs related to Argonaute 3 Antibody (NBP1-54932).

Blogs on Argonaute 3

There are no specific blogs for Argonaute 3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Argonaute 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGO3
Entrez
Uniprot