Argininosuccinate Lyase Antibody

Images

 
Western Blot: Argininosuccinate Lyase Antibody [H00000435-D01P] - Analysis of ASL expression in mouse kidney.
Western Blot: Argininosuccinate Lyase Antibody [H00000435-D01P] - Analysis of ASL expression in human liver.
Western Blot: Argininosuccinate Lyase Antibody [H00000435-D01P] - Analysis of ASL expression in transfected 293T cell line by ASL polyclonal antibody.Lane 1: ASL transfected lysate(51.70 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Argininosuccinate Lyase Antibody Summary

Immunogen
ASL (NP_000039.2, 1 a.a. - 464 a.a.) full-length human protein. MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA
Specificity
ASL - argininosuccinate lyase,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASL
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Argininosuccinate Lyase Antibody

  • argininosuccinase
  • argininosuccinate lyase
  • arginosuccinase
  • ASAL
  • EC 4.3.2.1

Background

This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-03107
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44192
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-58283
Species: Hu
Applications: ICC/IF
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55843
Species: Hu
Applications: ICC/IF
H00000435-D01P
Species: Hu, Mu
Applications: WB

Publications for Argininosuccinate Lyase Antibody (H00000435-D01P) (0)

There are no publications for Argininosuccinate Lyase Antibody (H00000435-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Argininosuccinate Lyase Antibody (H00000435-D01P) (0)

There are no reviews for Argininosuccinate Lyase Antibody (H00000435-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Argininosuccinate Lyase Antibody (H00000435-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Argininosuccinate Lyase Products

Bioinformatics Tool for Argininosuccinate Lyase Antibody (H00000435-D01P)

Discover related pathways, diseases and genes to Argininosuccinate Lyase Antibody (H00000435-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Argininosuccinate Lyase Antibody (H00000435-D01P)

Discover more about diseases related to Argininosuccinate Lyase Antibody (H00000435-D01P).
 

Pathways for Argininosuccinate Lyase Antibody (H00000435-D01P)

View related products by pathway.

PTMs for Argininosuccinate Lyase Antibody (H00000435-D01P)

Learn more about PTMs related to Argininosuccinate Lyase Antibody (H00000435-D01P).

Blogs on Argininosuccinate Lyase

There are no specific blogs for Argininosuccinate Lyase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Argininosuccinate Lyase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASL
Entrez
Uniprot