ARF6 Antibody

Images

 
Western Blot: ARF6 Antibody [NBP1-58310] - Titration: 0.2-1ug/ml, Positive Control: MCF7 cell Lysate
Immunohistochemistry-Paraffin: ARF6 Antibody [NBP1-58310] - Human Brain Tissue (Cerebellum), antibody concentration 5 ug/ml.
Western Blot: ARF6 Antibody [NBP1-58310] - Titration: 2 ug/ml Positive Control: Human NT-2 cells and Mouse WT brain.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Sh, ZeSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARF6 Antibody Summary

Immunogen
Synthetic peptides corresponding to ARF6(ADP-ribosylation factor 6) The peptide sequence was selected from the middle region of ARF6. Peptide sequence REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Canine (100%), Sheep (100%), Equine (100%), Rabbit (100%), Bovine (100%), Guinea Pig (100%), Zebrafish (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ARF6 and was validated on Western blot.
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARF6 Antibody

  • ADP-ribosylation factor 6
  • DKFZp564M0264

Background

ARF6 is a member of the human ARF family, which is part of the RAS superfamily. They are small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. ARF6 is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00009266-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA
H00005662-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-91266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-81958
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
AF6260
Species: Hu
Applications: WB
AF5615
Species: Hu
Applications: WB
NBP2-95233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
H00000381-M01
Species: Hu, Mu, Rt, Ba, Ca
Applications: WB, ELISA, ICC/IF
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-91273
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP1-58310
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Sh, Ze
Applications: WB, IHC, IHC-P

Publications for ARF6 Antibody (NBP1-58310) (0)

There are no publications for ARF6 Antibody (NBP1-58310).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARF6 Antibody (NBP1-58310) (0)

There are no reviews for ARF6 Antibody (NBP1-58310). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARF6 Antibody (NBP1-58310). (Showing 1 - 2 of 2 FAQ).

  1. We would like to buy a myristoylated Arf6 purified protein. If you have myristoylated Arf6 purified protein, please let me know.
    • Unfortunately, due to our expression system as well as Abnova's, we do not believe that these proteins have post-translational modifications similar to the endogenous protein
  2. I saw another protein purified product ARF6, which is expressed in E.coli. Did you expressed that protein with n-myristoyltransferase co-transformation E.coli?
    • We do not express the ARF6 protein with n-myristoyltransferase co-transformation E.coli.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARF6 Products

Bioinformatics Tool for ARF6 Antibody (NBP1-58310)

Discover related pathways, diseases and genes to ARF6 Antibody (NBP1-58310). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARF6 Antibody (NBP1-58310)

Discover more about diseases related to ARF6 Antibody (NBP1-58310).
 

Pathways for ARF6 Antibody (NBP1-58310)

View related products by pathway.

PTMs for ARF6 Antibody (NBP1-58310)

Learn more about PTMs related to ARF6 Antibody (NBP1-58310).
 

Research Areas for ARF6 Antibody (NBP1-58310)

Find related products by research area.

Blogs on ARF6

There are no specific blogs for ARF6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARF6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARF6
Uniprot