ARF6 Antibody Summary
Immunogen |
Synthetic peptides corresponding to ARF6(ADP-ribosylation factor 6) The peptide sequence was selected from the middle region of ARF6. Peptide sequence REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species |
Rat (100%), Canine (100%), Sheep (100%), Equine (100%), Rabbit (100%), Bovine (100%), Guinea Pig (100%), Zebrafish (100%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ARF6 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:100-1:2000
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
|
Application Notes |
This is a rabbit polyclonal antibody against ARF6 and was validated on Western blot. |
Theoretical MW |
20 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for ARF6 Antibody
Background
ARF6 is a member of the human ARF family, which is part of the RAS superfamily. They are small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. ARF6 is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Ba, Ca
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Sh, Ze
Applications: WB, IHC, IHC-P
Publications for ARF6 Antibody (NBP1-58310) (0)
There are no publications for ARF6 Antibody (NBP1-58310).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ARF6 Antibody (NBP1-58310) (0)
There are no reviews for ARF6 Antibody (NBP1-58310).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ARF6 Antibody (NBP1-58310). (Showing 1 - 2 of 2 FAQ).
-
We would like to buy a myristoylated Arf6 purified protein. If you have myristoylated Arf6 purified protein, please let me know.
- Unfortunately, due to our expression system as well as Abnova's, we do not believe that these proteins have post-translational modifications similar to the endogenous protein
-
I saw another protein purified product ARF6, which is expressed in E.coli. Did you expressed that protein with n-myristoyltransferase co-transformation E.coli?
- We do not express the ARF6 protein with n-myristoyltransferase co-transformation E.coli.
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional ARF6 Products
Bioinformatics Tool for ARF6 Antibody (NBP1-58310)
Discover related pathways, diseases and genes to ARF6 Antibody (NBP1-58310). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for ARF6 Antibody (NBP1-58310)
Discover more about diseases related to ARF6 Antibody (NBP1-58310).
| | Pathways for ARF6 Antibody (NBP1-58310)
View related products by pathway.
|
PTMs for ARF6 Antibody (NBP1-58310)
Learn more about PTMs related to ARF6 Antibody (NBP1-58310).
| | Research Areas for ARF6 Antibody (NBP1-58310)
Find related products by research area.
|
Blogs on ARF6