Novus Biologicals products are now on bio-techne.com

ARF6 Antibody

Images

 
Western Blot: ARF6 Antibody [NBP1-58310] - Titration: 0.2-1ug/ml, Positive Control: MCF7 cell Lysate
Immunohistochemistry-Paraffin: ARF6 Antibody [NBP1-58310] - Human Brain Tissue (Cerebellum), antibody concentration 5 ug/ml.
Western Blot: ARF6 Antibody [NBP1-58310] - Titration: 2 ug/ml Positive Control: Human NT-2 cells and Mouse WT brain.

Product Details

Summary
Reactivity Hu, BvSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

ARF6 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to ARF6(ADP-ribosylation factor 6) The peptide sequence was selected from the middle region of ARF6. Peptide sequence REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARF6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-58310.

Reactivity Notes

Use in Bovine reported in scientific literature (PMID:34367882)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for ARF6 Antibody

  • ADP-ribosylation factor 6
  • ARF6
  • DKFZp564M0264
  • EC 3.6.5.2

Background

ARF6 is a member of the human ARF family, which is part of the RAS superfamily. They are small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. ARF6 is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29906
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00009266-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
H00005662-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-81958
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF6260
Species: Hu
Applications: WB
AF5615
Species: Hu
Applications: WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
H00000381-M01
Species: Ba, Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
2914-HT
Species: Hu
Applications: BA
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-58310
Species: Hu, Bv
Applications: WB, IHC

Publications for ARF6 Antibody (NBP1-58310)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for ARF6 Antibody (NBP1-58310) (0)

There are no reviews for ARF6 Antibody (NBP1-58310). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARF6 Antibody (NBP1-58310). (Showing 1 - 2 of 2 FAQ).

  1. We would like to buy a myristoylated Arf6 purified protein. If you have myristoylated Arf6 purified protein, please let me know.
    • Unfortunately, due to our expression system as well as Abnova's, we do not believe that these proteins have post-translational modifications similar to the endogenous protein
  2. I saw another protein purified product ARF6, which is expressed in E.coli. Did you expressed that protein with n-myristoyltransferase co-transformation E.coli?
    • We do not express the ARF6 protein with n-myristoyltransferase co-transformation E.coli.

Secondary Antibodies

 

Isotype Controls

Additional ARF6 Products

Research Areas for ARF6 Antibody (NBP1-58310)

Find related products by research area.

Blogs on ARF6

There are no specific blogs for ARF6, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARF6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARF6
Uniprot