Synthetic peptides corresponding to ARF6(ADP-ribosylation factor 6) The peptide sequence was selected from the middle region of ARF6. Peptide sequence REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
This is a rabbit polyclonal antibody against ARF6 and was validated on Western blot.
Theoretical MW
20 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Use in Bovine reported in scientific literature (PMID:34367882)
Packaging, Storage & Formulations
Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for ARF6 Antibody
ADP-ribosylation factor 6
ARF6
DKFZp564M0264
EC 3.6.5.2
Background
ARF6 is a member of the human ARF family, which is part of the RAS superfamily. They are small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. ARF6 is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for ARF6 Antibody (NBP1-58310). (Showing 1 - 2 of 2 FAQ).
We would like to buy a myristoylated Arf6 purified protein. If you have myristoylated Arf6 purified protein, please let me know.
Unfortunately, due to our expression system as well as Abnova's, we do not believe that these proteins have post-translational modifications similar to the endogenous protein
I saw another protein purified product ARF6, which is expressed in E.coli. Did you expressed that protein with n-myristoyltransferase co-transformation E.coli?
We do not express the ARF6 protein with n-myristoyltransferase co-transformation E.coli.
Bioinformatics Tool for ARF6 Antibody (NBP1-58310)
Discover related pathways, diseases and genes to ARF6 Antibody (NBP1-58310). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for ARF6 Antibody (NBP1-58310)
Discover more about diseases related to ARF6 Antibody (NBP1-58310).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our ARF6 Antibody and receive a gift card or discount.