Aquaporin-8 Antibody - BSA Free

Western Blot: Aquaporin-8 Antibody - BSA Free [NBP2-92557] - Western blot analysis of various lysates using Aquaporin-8 Rabbit pAb at 1:1000 dilution. Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection:ECL Basic Kit. Exposuretime: 90s.

Western Blot: Aquaporin-8 Antibody - BSA Free [NBP2-92557] - Western blot analysis of lysates from Rat liver, using Aquaporin-8 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: Aquaporin-8 Antibody - BSA Free [NBP2-92557] - Immunofluorescence analysis of NIH/3T3 cells using Aquaporin-8 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: Aquaporin-8 Antibody [NBP2-92557] - Analysis of C6 cells using AQP8 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Aquaporin-8 Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Aquaporin-8 (NP_001160.2). MLIGGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTTLLALAVCMGAINEKTKGPLAPFSIGFAVTVDILA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AQP8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Aquaporin-8 Antibody - BSA Free

• AQP-8
• aquaporin 8
• aquaporin-8

Background

Aquaporin 8 (AQP8) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 8 mRNA is found in pancreas and colon but not other tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AQP8