![Western Blot: Aquaporin-3 Antibody [NBP2-92885] - Analysis of extracts of various cell lines, using AQP3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize2/Aquaporin-3-Antibody-Western-Blot-NBP2-92885-img0006.jpg "Western Blot: Aquaporin-3 Antibody [NBP2-92885] - Analysis of extracts of various cell lines, using AQP3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 178-292 of human AQP3 (NP_004916.1). IVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSAVFTTGQHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEENVKLAHVKHKEQI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AQP3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Aquaporin-3 antibody validated for IHC-P from a verified customer review. |
|
| Reviewed Applications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 50% glycerol, pH 7.3. |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
-Immunohistochemistry-NB600-749-img0001.jpg)
-Immunohistochemistry-NB600-749-img0003.jpg)
-Immunohistochemistry-NB600-749-img0002.jpg)
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
-Immunohistochemistry-Paraffin-NBP1-47842-img0019.jpg)
-Immunoprecipitation-NBP1-47842-img0023.jpg)
-Immunohistochemistry-Paraffin-NBP1-47842-img0003.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Edward van Beelen |
IHC-P | Human | 12/24/2020 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for Aquaporin-3 Antibody (NBP2-92885)Discover more about diseases related to Aquaporin-3 Antibody (NBP2-92885).
| Pathways for Aquaporin-3 Antibody (NBP2-92885)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AQP3 |
![Immunocytochemistry/Immunofluorescence: Aquaporin-3 Antibody [NBP2-92885] - Analysis of mouse kidney cells using AQP3 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize2/Aquaporin-3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92885-img0009.jpg "Immunocytochemistry/Immunofluorescence: Aquaporin-3 Antibody [NBP2-92885] - Analysis of mouse kidney cells using AQP3 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry: Aquaporin-3 Antibody [NBP2-92885] - Immunofluorescence analysis of mouse kidney using Aquaporin-3 antibody (NBP2-92885) at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize2/Aquaporin-3-Antibody-Immunohistochemistry-NBP2-92885-img0011.jpg "Immunohistochemistry: Aquaporin-3 Antibody [NBP2-92885] - Immunofluorescence analysis of mouse kidney using Aquaporin-3 antibody (NBP2-92885) at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: Aquaporin-3 Antibody [NBP2-92885] - Rat kidney cells using AQP3 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize2/Aquaporin-3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92885-img0007.jpg "Immunocytochemistry/Immunofluorescence: Aquaporin-3 Antibody [NBP2-92885] - Rat kidney cells using AQP3 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: Aquaporin-3 Antibody [NBP2-92885] - Analysis of human kidney cells using AQP3 Rabbit pAb ait dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize2/Aquaporin-3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92885-img0008.jpg "Immunocytochemistry/Immunofluorescence: Aquaporin-3 Antibody [NBP2-92885] - Analysis of human kidney cells using AQP3 Rabbit pAb ait dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-92885] - Mouse kidney using AQP3 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize2/Aquaporin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-92885-img0004.jpg "Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-92885] - Mouse kidney using AQP3 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-92885] - Rat kidney using AQP3 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize2/Aquaporin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-92885-img0005.jpg "Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-92885] - Rat kidney using AQP3 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry: Aquaporin-3 Antibody [NBP2-92885] - Immunofluorescence analysis of rat kidney using Aquaporin-3 antibody (NBP2-92885) at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize2/Aquaporin-3-Antibody-Immunohistochemistry-NBP2-92885-img0010.jpg "Immunohistochemistry: Aquaporin-3 Antibody [NBP2-92885] - Immunofluorescence analysis of rat kidney using Aquaporin-3 antibody (NBP2-92885) at dilution of 1:100. Blue: DAPI for nuclear staining.")
-Western-Blot-H00000343-M01-img0007.jpg)
-ELISA-H00000343-M01-img0004.jpg)
-Western-Blot-H00000343-M01-img0005.jpg)
![Western Blot IFN-alpha/beta R1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af245_mouse-tsp50-affinity-purified-polyclonal-ab-western-blot-672022104711.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
